Protein Family IF00140

Metagenome Isolate
164 Members
54 Samples
156 Scaffolds
78.79 Avg Length

🧬 Representative Sequence

ID
2225789004|2227226648|2227661461
Length
76 aa
Sequence
MEGRQIDKATSDKISFISFIVPAFAEAYKMPIPFKYLKKYGGWDFLNEHWWALHTDNDIWAIHDIYEICYKNGGVR

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.9%
Kalotermitidae 18.5%
Unclassified 16.7%
Rhinotermitidae 5.6%
Termopsidae 3.7%
Passalidae 3.7%

🌳 Taxonomy

Archaea 1
Bacteria 139
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
2 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
3 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
4 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
5 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
6 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
34 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
51 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
52 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_066161 3300042611 Bacteria 1346
2 Ga0123356_10781809 3300010049 Bacteria 1125
3 Ga0123356_11329807 3300010049 Unclassified 881
4 Ga0123353_10086326 3300010167 Unclassified 5053
5 Ga0123354_10358767 3300010882 Unclassified 1288
6 Ga0123354_10648418 3300010882 Unclassified 755
7 Ga0466711_252001 3300042615 Bacteria 1969
8 Ga0466657_172699 3300042582 Bacteria 1344
9 Ga0466692_017761 3300042591 Bacteria 14021
10 Ga0466693_170493 3300042592 Bacteria 3398
11 Ga0466734_165774 3300042623 Bacteria 2748
12 Ga0466703_165272 3300042636 Bacteria 3549
13 Ga0466725_177993 3300042654 Bacteria 1652
14 Ga0466716_044743 3300042605 Bacteria 6810
15 2227166937 2225789004 Bacteria 8265
16 2227505861 2225789004 Unclassified 720
17 2227521350 2225789004 Unclassified 662
18 IMNBL1DRAFT_c0052156 3300000062 Unclassified 1283
19 IMNBL1DRAFT_c0087814 3300000062 Bacteria 858
20 JGI24702J35022_10600641 3300002462 Bacteria 681
21 JGI24705J35276_12232988 3300002504 Bacteria 4604
22 Ga0068302_10066918 3300005071 Bacteria 9116
23 Ga0466732_056060 3300042656 Bacteria 2000
24 Ga0123356_10067729 3300010049 Bacteria 3344
25 Ga0123356_13107910 3300010049 Bacteria 579
26 Ga0123353_10433535 3300010167 Unclassified 1942
27 Ga0123354_10001649 3300010882 Bacteria 27786
28 Ga0466726_080294 3300042619 Archaea 3975
29 Ga0466690_195816 3300042590 Bacteria 1810
30 Ga0466692_043923 3300042591 Bacteria 2962
31 Ga0466691_021948 3300042593 Bacteria 25667
32 Ga0466699_334397 3300042597 Unclassified 1064
33 Ga0466731_000737 3300042622 Bacteria 3496
34 Ga0466724_63228 3300042649 Bacteria 3841
35 Ga0466700_309588 3300042600 Bacteria 264576
36 2227219691 2225789004 Bacteria 7517
37 IMNBL1DRAFT_c0024430 3300000062 Bacteria 2343
38 IMNBL1DRAFT_c0062900 3300000062 Bacteria 1106
39 JGI24702J35022_10243315 3300002462 Bacteria 1044
40 JGI24702J35022_10452812 3300002462 Bacteria 782
41 JGI24705J35276_12218373 3300002504 Bacteria 2141
42 Ga0466697_168511 3300042611 Bacteria 1189
43 Ga0466733_014817 3300042659 Bacteria 2239
44 Ga0123357_10047766 3300009784 Bacteria 5801
45 Ga0123357_10388649 3300009784 Bacteria 1285
46 Ga0123353_10785800 3300010167 Bacteria 1317
47 Ga0123353_10935045 3300010167 Bacteria 1175
48 Ga0466710_322096 3300042613 Bacteria 1261
49 Ga0466711_324273 3300042615 Bacteria 1011
50 Ga0466711_435871 3300042615 Bacteria 2616
51 Ga0466729_115246 3300042621 Unclassified 1538
52 Ga0466693_079792 3300042592 Bacteria 4480
53 Ga0466691_060892 3300042593 Bacteria 5521
54 Ga0466703_081490 3300042636 Bacteria 1656
55 Ga0466709_035200 3300042648 Bacteria 1572
56 Ga0466709_092725 3300042648 Bacteria 4700
57 Ga0466724_55836 3300042649 Bacteria 1636
58 Ga0466725_267298 3300042654 Bacteria 11477
59 Ga0466707_053362 3300042601 Bacteria 22799
60 IMNBL1DRAFT_c0007042 3300000062 Bacteria 5993
61 JGI24696J40584_12609036 3300002834 Bacteria 663
62 JGI24696J40584_12882847 3300002834 Bacteria 1092
63 JGI24696J40584_12904682 3300002834 Bacteria 1209
64 JGI24696J40584_12936287 3300002834 Bacteria 1577
65 Ga0466732_441409 3300042656 Bacteria 1565
66 Ga0466733_132946 3300042659 Bacteria 5748
67 Ga0123357_10920829 3300009784 Bacteria 560
68 Ga0123353_10277759 3300010167 Bacteria 2575
69 Ga0123353_10939954 3300010167 Unclassified 1171
70 Ga0123354_10126615 3300010882 Bacteria 3258
71 Ga0123354_10435987 3300010882 Unclassified 1075
72 Ga0466729_106334 3300042621 Bacteria 1436
73 Ga0466694_217935 3300042594 Unclassified 1027
74 Ga0466696_312848 3300042596 Unclassified 1230
75 Ga0466731_063916 3300042622 Bacteria 1203
76 Ga0466703_256509 3300042636 Bacteria 3956
77 Ga0466714_114622 3300042603 Bacteria 1721
78 Ga0466720_122752 3300042607 Bacteria 2052
79 Ga0466722_080343 3300042609 Bacteria 16839
80 Ga0466698_248314 3300042610 Unclassified 1091
81 Ga0466698_341758 3300042610 Bacteria 1287
82 IMNBL1DRAFT_c0022723 3300000062 Bacteria 2474
83 IMNBL1DRAFT_c0043381 3300000062 Bacteria 1489
84 JGI24696J40584_12946058 3300002834 Unclassified 1880
85 Ga0123355_10000242 3300009826 Bacteria 70195
86 Ga0123356_11636075 3300010049 Bacteria 798
87 Ga0466712_289297 3300042614 Bacteria 1385
88 Ga0415639_194964 3300038395 Bacteria 2042
89 Ga0466657_065687 3300042582 Bacteria 3412
90 Ga0466691_075177 3300042593 Bacteria 26045
91 Ga0466691_077113 3300042593 Bacteria 29256
92 Ga0466694_119890 3300042594 Bacteria 2062
93 Ga0466709_064425 3300042648 Bacteria 43572
94 Ga0466719_181310 3300042606 Unclassified 1018
95 2227206920 2225789004 Unclassified 1423
96 IMNBL1DRAFT_c0014330 3300000062 Bacteria 3505
97 IMNBL1DRAFT_c0017503 3300000062 Unclassified 3014
98 IMNBL1DRAFT_c0070556 3300000062 Bacteria 1010
99 JGI24702J35022_10003812 3300002462 Bacteria 9047
100 JGI24696J40584_12864991 3300002834 Bacteria 1025
101 Ga0123355_10000533 3300009826 Bacteria 50893
102 Ga0123356_10179852 3300010049 Unclassified 2136
103 Ga0123353_11130968 3300010167 Unclassified 1036
104 Ga0123353_11640577 3300010167 Bacteria 809
105 Ga0123353_12128914 3300010167 Bacteria 682
106 Ga0123354_10105532 3300010882 Bacteria 3769
107 Ga0466711_185234 3300042615 Bacteria 2827
108 Ga0466711_446086 3300042615 Bacteria 1409
109 Ga0466656_144242 3300042550 Bacteria 1136
110 Ga0466693_227863 3300042592 Bacteria 3679
111 Ga0466691_135808 3300042593 Bacteria 2062
112 Ga0466694_103377 3300042594 Bacteria 1300
113 Ga0466694_239713 3300042594 Bacteria 1017
114 Ga0466703_038583 3300042636 Unclassified 3540
115 Ga0466704_423827 3300042643 Bacteria 1651
116 Ga0466700_188545 3300042600 Bacteria 1927
117 Ga0466714_011122 3300042603 Bacteria 3612
118 Ga0466716_187693 3300042605 Bacteria 1313
119 2227226648 2225789004 Bacteria 1375
120 Ga0466697_098905 3300042611 Bacteria 2182
121 Ga0466697_134912 3300042611 Bacteria 1488
122 Ga0123354_10174470 3300010882 Bacteria 2485
123 Ga0123354_10218569 3300010882 Bacteria 2033
124 Ga0466729_050961 3300042621 Bacteria 1745
125 Ga0466656_023557 3300042550 Bacteria 1149
126 Ga0466657_067503 3300042582 Bacteria 1038
127 Ga0466657_311002 3300042582 Bacteria 1305
128 Ga0466693_266818 3300042592 Unclassified 1027
129 Ga0466708_361487 3300042652 Bacteria 4560
130 Ga0466725_324598 3300042654 Bacteria 1487
131 2227481595 2225789004 Bacteria 4417
132 2227637119 2225789004 Bacteria 2083
133 IMNBL1DRAFT_c0000206 3300000062 Bacteria 51916
134 IMNBL1DRAFT_c0000218 3300000062 Bacteria 50480
135 IMNBL1DRAFT_c0019169 3300000062 Bacteria 2813
136 JGI24702J35022_10039367 3300002462 Bacteria 2522
137 JGI24696J40584_12459794 3300002834 Bacteria 580
138 Ga0072940_1183835 3300005200 Bacteria 733
139 Ga0123356_10043058 3300010049 Bacteria 4204
140 Ga0123353_10009327 3300010167 Bacteria 13528
141 Ga0123353_10049282 3300010167 Bacteria 6709
142 Ga0123353_10435471 3300010167 Bacteria 1936
143 Ga0123354_10340407 3300010882 Unclassified 1353
144 Ga0466712_204921 3300042614 Bacteria 1994
145 Ga0466711_166303 3300042615 Bacteria 4191
146 Ga0466656_337827 3300042550 Bacteria 1850
147 Ga0466704_159613 3300042643 Bacteria 1720
148 Ga0466707_055464 3300042601 Bacteria 6977
149 Ga0466707_344637 3300042601 Bacteria 4639
150 Ga0466714_089083 3300042603 Bacteria 1545
151 Ga0466722_053071 3300042609 Bacteria 1225
152 2227560456 2225789004 Bacteria 2729
153 2227649622 2225789004 Bacteria 10818
154 IMNBL1DRAFT_c0001231 3300000062 Bacteria 19329
155 IMNBL1DRAFT_c0045994 3300000062 Bacteria 1420
156 JGI24705J35276_12189607 3300002504 Bacteria 1453

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042623 Ga0466734_165774 Ga0466734_165774_2319_2540 73
2 3300042636 Ga0466703_038583 Ga0466703_038583_1309_1530 73
3 3300042636 Ga0466703_081490 Ga0466703_081490_1067_1288 73
4 3300042636 Ga0466703_256509 Ga0466703_256509_2790_3011 73
5 3300042594 Ga0466694_217935 Ga0466694_217935_207_431 74
6 3300042605 Ga0466716_187693 Ga0466716_187693_660_884 74
7 2225789004 2227226648 2227661461 76
8 3300010882 Ga0123354_10435987 Ga0123354_104359872 76
9 3300042582 Ga0466657_065687 Ga0466657_065687_2279_2509 76
10 3300042603 Ga0466714_011122 Ga0466714_011122_1237_1467 76
11 3300002834 JGI24696J40584_12609036 JGI24696J40584_126090362 77
12 3300042550 Ga0466656_023557 Ga0466656_023557_478_711 77
13 3300042590 Ga0466690_195816 Ga0466690_195816_241_474 77
14 3300042591 Ga0466692_017761 Ga0466692_017761_8242_8475 77
15 3300042593 Ga0466691_021948 Ga0466691_021948_6851_7084 77
16 3300042601 Ga0466707_053362 Ga0466707_053362_21127_21360 77
17 3300042601 Ga0466707_055464 Ga0466707_055464_2029_2262 77
18 3300042601 Ga0466707_344637 Ga0466707_344637_2193_2426 77
19 3300042605 Ga0466716_044743 Ga0466716_044743_6204_6437 77
20 3300042619 Ga0466726_080294 Ga0466726_080294_2872_3105 77
21 3300042621 Ga0466729_115246 Ga0466729_115246_76_309 77
22 3300042648 Ga0466709_092725 Ga0466709_092725_2828_3061 77
23 3300042652 Ga0466708_361487 Ga0466708_361487_16_249 77
24 iso_pr_bacteria 2967483437 2967485715 77
25 2225789004 2227166937 2227579711 78
26 2225789004 2227206920 2227634517 78
27 2225789004 2227219691 2227652161 78
28 2225789004 2227481595 2227942645 78
29 2225789004 2227505861 2227993553 78
30 2225789004 2227521350 2228024917 78
31 2225789004 2227560456 2228096682 78
32 2225789004 2227637119 2228224554 78
33 2225789004 2227649622 2228244508 78
34 3300002462 JGI24702J35022_10600641 JGI24702J35022_106006411 78
35 3300042550 Ga0466656_337827 Ga0466656_337827_1565_1801 78
36 3300042582 Ga0466657_172699 Ga0466657_172699_349_585 78
37 3300042591 Ga0466692_043923 Ga0466692_043923_524_760 78
38 3300042592 Ga0466693_079792 Ga0466693_079792_1477_1713 78
39 3300042592 Ga0466693_170493 Ga0466693_170493_1681_1917 78
40 3300042592 Ga0466693_227863 Ga0466693_227863_1097_1333 78
41 3300042592 Ga0466693_266818 Ga0466693_266818_610_846 78
42 3300042593 Ga0466691_077113 Ga0466691_077113_10413_10649 78
43 3300042594 Ga0466694_103377 Ga0466694_103377_538_774 78
44 3300042594 Ga0466694_119890 Ga0466694_119890_925_1161 78
45 3300042594 Ga0466694_239713 Ga0466694_239713_384_620 78
46 3300042596 Ga0466696_312848 Ga0466696_312848_342_578 78
47 3300042597 Ga0466699_334397 Ga0466699_334397_164_400 78
48 3300042600 Ga0466700_188545 Ga0466700_188545_327_563 78
49 3300042600 Ga0466700_309588 Ga0466700_309588_164262_164498 78
50 3300042603 Ga0466714_089083 Ga0466714_089083_256_492 78
51 3300042603 Ga0466714_114622 Ga0466714_114622_1249_1485 78
52 3300042607 Ga0466720_122752 Ga0466720_122752_979_1215 78
53 3300042609 Ga0466722_053071 Ga0466722_053071_722_958 78
54 3300042609 Ga0466722_080343 Ga0466722_080343_8706_8942 78
55 3300042610 Ga0466698_248314 Ga0466698_248314_723_959 78
56 3300042611 Ga0466697_066161 Ga0466697_066161_243_479 78
57 3300042611 Ga0466697_098905 Ga0466697_098905_353_589 78
58 3300042611 Ga0466697_168511 Ga0466697_168511_217_453 78
59 3300042613 Ga0466710_322096 Ga0466710_322096_301_537 78
60 3300042614 Ga0466712_289297 Ga0466712_289297_831_1067 78
61 3300042615 Ga0466711_185234 Ga0466711_185234_2527_2763 78
62 3300042615 Ga0466711_252001 Ga0466711_252001_451_687 78
63 3300042615 Ga0466711_324273 Ga0466711_324273_629_865 78
64 3300042615 Ga0466711_435871 Ga0466711_435871_1531_1767 78
65 3300042615 Ga0466711_446086 Ga0466711_446086_263_499 78
66 3300042621 Ga0466729_050961 Ga0466729_050961_412_648 78
67 3300042622 Ga0466731_000737 Ga0466731_000737_2881_3117 78
68 3300042622 Ga0466731_063916 Ga0466731_063916_241_477 78
69 3300042636 Ga0466703_165272 Ga0466703_165272_3225_3461 78
70 3300042643 Ga0466704_159613 Ga0466704_159613_1311_1547 78
71 3300042643 Ga0466704_423827 Ga0466704_423827_174_410 78
72 3300042648 Ga0466709_035200 Ga0466709_035200_431_667 78
73 3300042648 Ga0466709_064425 Ga0466709_064425_1721_1957 78
74 3300042649 Ga0466724_55836 Ga0466724_55836_106_342 78
75 3300042649 Ga0466724_63228 Ga0466724_63228_674_910 78
76 3300042654 Ga0466725_177993 Ga0466725_177993_1015_1251 78
77 3300042654 Ga0466725_267298 Ga0466725_267298_5494_5730 78
78 3300042656 Ga0466732_441409 Ga0466732_441409_965_1201 78
79 3300042659 Ga0466733_014817 Ga0466733_014817_440_676 78
80 3300042659 Ga0466733_132946 Ga0466733_132946_4708_4944 78
81 iso_pr_bacteria 2820205024 2820205781 78
82 iso_pr_bacteria 2820740053 2820741038 78
83 iso_pr_bacteria 2820744581 2820745443 78
84 iso_pr_bacteria 2820751898 2820752249 78
85 iso_pr_bacteria 2820765201 2820765623 78
86 iso_pr_bacteria 2820785563 2820786204 78
87 iso_pr_bacteria 2820789850 2820791449 78
88 3300000062 IMNBL1DRAFT_c0000206 IMNBL1DRAFT_000020629 79
89 3300000062 IMNBL1DRAFT_c0000218 IMNBL1DRAFT_00002184 79
90 3300000062 IMNBL1DRAFT_c0001231 IMNBL1DRAFT_00012315 79
91 3300000062 IMNBL1DRAFT_c0007042 IMNBL1DRAFT_000704211 79
92 3300000062 IMNBL1DRAFT_c0014330 IMNBL1DRAFT_00143303 79
93 3300000062 IMNBL1DRAFT_c0017503 IMNBL1DRAFT_00175032 79
94 3300000062 IMNBL1DRAFT_c0019169 IMNBL1DRAFT_00191692 79
95 3300000062 IMNBL1DRAFT_c0022723 IMNBL1DRAFT_00227233 79
96 3300000062 IMNBL1DRAFT_c0024430 IMNBL1DRAFT_00244302 79
97 3300000062 IMNBL1DRAFT_c0043381 IMNBL1DRAFT_00433813 79
98 3300000062 IMNBL1DRAFT_c0045994 IMNBL1DRAFT_00459942 79
99 3300000062 IMNBL1DRAFT_c0052156 IMNBL1DRAFT_00521563 79
100 3300000062 IMNBL1DRAFT_c0062900 IMNBL1DRAFT_00629002 79
101 3300000062 IMNBL1DRAFT_c0070556 IMNBL1DRAFT_00705562 79
102 3300002462 JGI24702J35022_10003812 JGI24702J35022_100038124 79
103 3300002462 JGI24702J35022_10039367 JGI24702J35022_100393672 79
104 3300002462 JGI24702J35022_10243315 JGI24702J35022_102433152 79
105 3300002462 JGI24702J35022_10452812 JGI24702J35022_104528121 79
106 3300002504 JGI24705J35276_12189607 JGI24705J35276_121896071 79
107 3300002504 JGI24705J35276_12218373 JGI24705J35276_122183731 79
108 3300002504 JGI24705J35276_12232988 JGI24705J35276_122329888 79
109 3300002834 JGI24696J40584_12459794 JGI24696J40584_124597942 79
110 3300002834 JGI24696J40584_12864991 JGI24696J40584_128649912 79
111 3300002834 JGI24696J40584_12882847 JGI24696J40584_128828472 79
112 3300002834 JGI24696J40584_12904682 JGI24696J40584_129046821 79
113 3300002834 JGI24696J40584_12936287 JGI24696J40584_129362873 79
114 3300002834 JGI24696J40584_12946058 JGI24696J40584_129460583 79
115 3300005071 Ga0068302_10066918 Ga0068302_100669184 79
116 3300005200 Ga0072940_1183835 Ga0072940_11838352 79
117 3300009784 Ga0123357_10047766 Ga0123357_100477664 79
118 3300009784 Ga0123357_10388649 Ga0123357_103886492 79
119 3300009784 Ga0123357_10920829 Ga0123357_109208292 79
120 3300009826 Ga0123355_10000242 Ga0123355_100002423 79
121 3300009826 Ga0123355_10000533 Ga0123355_100005333 79
122 3300010049 Ga0123356_10043058 Ga0123356_100430581 79
123 3300010049 Ga0123356_10067729 Ga0123356_100677296 79
124 3300010049 Ga0123356_10179852 Ga0123356_101798522 79
125 3300010049 Ga0123356_10781809 Ga0123356_107818092 79
126 3300010049 Ga0123356_11329807 Ga0123356_113298072 79
127 3300010049 Ga0123356_11636075 Ga0123356_116360752 79
128 3300010049 Ga0123356_13107910 Ga0123356_131079102 79
129 3300010167 Ga0123353_10009327 Ga0123353_1000932711 79
130 3300010167 Ga0123353_10049282 Ga0123353_100492829 79
131 3300010167 Ga0123353_10086326 Ga0123353_100863264 79
132 3300010167 Ga0123353_10277759 Ga0123353_102777593 79
133 3300010167 Ga0123353_10433535 Ga0123353_104335352 79
134 3300010167 Ga0123353_10435471 Ga0123353_104354712 79
135 3300010167 Ga0123353_10785800 Ga0123353_107858001 79
136 3300010167 Ga0123353_10935045 Ga0123353_109350452 79
137 3300010167 Ga0123353_11130968 Ga0123353_111309682 79
138 3300010167 Ga0123353_12128914 Ga0123353_121289141 79
139 3300010882 Ga0123354_10001649 Ga0123354_1000164920 79
140 3300010882 Ga0123354_10105532 Ga0123354_101055325 79
141 3300010882 Ga0123354_10126615 Ga0123354_101266153 79
142 3300010882 Ga0123354_10174470 Ga0123354_101744703 79
143 3300010882 Ga0123354_10218569 Ga0123354_102185692 79
144 3300010882 Ga0123354_10340407 Ga0123354_103404072 79
145 3300010882 Ga0123354_10358767 Ga0123354_103587673 79
146 3300010882 Ga0123354_10648418 Ga0123354_106484182 79
147 3300042606 Ga0466719_181310 Ga0466719_181310_186_425 79
148 3300042610 Ga0466698_341758 Ga0466698_341758_380_619 79
149 3300042621 Ga0466729_106334 Ga0466729_106334_852_1091 79
150 3300042654 Ga0466725_324598 Ga0466725_324598_640_879 79
151 3300010167 Ga0123353_10939954 Ga0123353_109399542 80
152 3300042593 Ga0466691_060892 Ga0466691_060892_231_473 80
153 3300042593 Ga0466691_075177 Ga0466691_075177_8464_8706 80
154 3300042593 Ga0466691_135808 Ga0466691_135808_161_403 80
155 3300042615 Ga0466711_166303 Ga0466711_166303_3667_3909 80
156 3300042614 Ga0466712_204921 Ga0466712_204921_696_947 83
157 3300042656 Ga0466732_056060 Ga0466732_056060_1491_1745 84
158 3300042550 Ga0466656_144242 Ga0466656_144242_211_471 86
159 3300042582 Ga0466657_067503 Ga0466657_067503_716_976 86
160 3300042582 Ga0466657_311002 Ga0466657_311002_387_647 86
161 3300042611 Ga0466697_134912 Ga0466697_134912_857_1120 87
162 3300000062 IMNBL1DRAFT_c0087814 IMNBL1DRAFT_00878142 91
163 3300038395 Ga0415639_194964 Ga0415639_194964_659_937 92
164 3300010167 Ga0123353_11640577 Ga0123353_116405772 114

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12668 DUF3791 Protein of unknown function (DUF3791) 16 71 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.