Protein Family IF00069

Metagenome Isolate
161 Members
68 Samples
101 Scaffolds
255.37 Avg Length

🧬 Representative Sequence

ID
2100351016|SWWA_contig02283__length_22774___numreads_1263|SWWA_00648890
Length
305 aa
Sequence
MLYRSLLLHLAIYLLQDPGLLQFIATRHEAATDPKMRHCFALGNCTMLQIDALPAFSDNYIWLLQDTTHKRCAVVDPGDAAPVLAWLARHPDWTLSDILVTHHHFDHVGGVAQLHGHTNAKVWGPALEDIPARQVALNDNDQIEILGLKFDVLLVPGHTLGHIAYYHADPSAPLLLCGDTLFAAGCGRLFEGTPEQMHRSLSRLAALPGHTGVYCTHEYTLSNLRFAQAVEPRNPDIAARVAQVTEWRAEGRISLPSTIALELLTNPFLRVNETSVKEKADEWKSRDNDSPGAVFASLRSWKDKF

📊 Sample Types

Isolate 37.3%
Metagenome 62.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🦗 Order Distribution

Amphipoda 0.0%
Anostraca 0.0%
Araneae 0.0%
Blattodea 0.0%
Calanoida 0.0%
Coleoptera 13.7%
Copepoda 0.0%
Decapoda 3.1%
Diplopoda 3.7%
Diplostraca 0.0%
Diptera 9.9%
Euphausiacea 0.0%
Hemiptera 1.2%
Hymenoptera 14.3%
Insect (unknown) 0.0%
Isopoda 3.7%
Isoptera 32.3%
Ixodida 0.0%
Lepidoptera 0.0%
Mecoptera 0.0%
NA 0.0%
Odonata 0.0%
Orthoptera 0.0%
Phthiraptera 2.5%
Psocodea 0.0%
Sarcoptiformes 0.0%
Siphonaptera 0.0%
Spirobolida 0.0%
Thysanoptera 0.6%
Trombidiformes 0.0%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeEnvironment
1 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Isoptera
2 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Isoptera
3 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome Diplopoda
4 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Isopoda
5 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Isopoda
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Isoptera
7 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Isoptera
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Isoptera
9 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Coleoptera
10 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Diptera
11 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Diptera
12 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Hymenoptera
13 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Hymenoptera
14 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Isopoda
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Isoptera
16 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Isoptera
17 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Hymenoptera
18 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Hymenoptera
19 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Isopoda
20 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Isoptera
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Isoptera
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Isoptera
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Isoptera
24 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Coleoptera
25 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Hymenoptera
26 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Diptera
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Isoptera
28 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Diptera
29 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Isopoda
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Isoptera
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Isoptera
32 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Isoptera
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Isoptera
34 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Coleoptera
35 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Hymenoptera
36 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Hymenoptera
37 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Diptera
38 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Hymenoptera
39 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome Diplopoda
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Isoptera
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Isoptera
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Isoptera
43 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Hymenoptera
44 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Hymenoptera
45 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Isopoda
46 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Diptera
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Isoptera
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Isoptera
49 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Coleoptera
50 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Hymenoptera
51 3300005320 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut Metagenome Diptera
52 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Hymenoptera
53 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Hymenoptera
54 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Diptera
55 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Hymenoptera
56 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome Diplopoda
57 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Isoptera
58 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Isoptera
59 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome Isoptera
60 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Hymenoptera
61 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Diptera
62 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Hymenoptera
63 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Isoptera
64 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome Diplopoda
65 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Diptera
66 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Isoptera
67 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Isoptera
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Isoptera

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_097121 3300042598 Bacteria 81630
2 SPBB_contig11512 2044078006 Bacteria 130870
3 Meta3P_1011862 3300002464 Bacteria 4269
4 Ga0074306_1121754 3300005309 Bacteria 1001
5 Ga0103266_1000009 3300007067 Bacteria 102792
6 Ga0104049_1131990 3300007103 Bacteria 1959
7 Ga0103264_1000389 3300007188 Bacteria 23064
8 Ga0103268_1000004 3300007192 Bacteria 80007
9 Ga0160472_100510 3300012839 Bacteria 25686
10 Ga0160443_115043 3300012848 Bacteria 842
11 Ga0466710_319477 3300042613 Bacteria 1733
12 Ga0466726_016069 3300042619 Bacteria 5655
13 Ga0466734_038905 3300042623 Bacteria 4557
14 Ga0466709_245063 3300042648 Bacteria 5743
15 Ga0466724_58698 3300042649 Bacteria 113523
16 Ga0466719_272288 3300042606 Unclassified 3298
17 SPBB_contig01219 2044078006 Bacteria 87486
18 Ga0103265_1000268 3300007068 Bacteria 8530
19 Ga0102735_1000560 3300007080 Bacteria 7785
20 Ga0104050_1002187 3300007153 Bacteria 12554
21 Ga0123357_10002169 3300009784 Bacteria 21628
22 Ga0160470_100031 3300012813 Bacteria 226314
23 Ga0466692_094430 3300042591 Bacteria 31474
24 Ga0466726_091316 3300042619 Bacteria 2691
25 Ga0466729_246494 3300042621 Bacteria 2102
26 Ga0466704_028879 3300042643 Bacteria 6128
27 Ga0466724_19171 3300042649 Bacteria 4406
28 Ga0466725_064713 3300042654 Bacteria 7103
29 Ga0466701_103385 3300042598 Bacteria 106939
30 Ga0466716_182145 3300042605 Bacteria 11006
31 FGTW_contig30567 2065487013 Bacteria 10951
32 Ga0074317_1038350 3300005320 Bacteria 2396
33 Ga0104019_1191910 3300007150 Bacteria 1708
34 Ga0123354_10213096 3300010882 Bacteria 2080
35 Ga0160431_104286 3300012828 Bacteria 2660
36 Ga0160467_102249 3300012829 Bacteria 4614
37 Ga0160433_100129 3300012846 Bacteria 68423
38 Ga0160435_1001456 3300012857 Bacteria 5996
39 Ga0466711_393167 3300042615 Bacteria 4284
40 Ga0466726_005840 3300042619 Bacteria 2512
41 Ga0466730_038135 3300042625 Bacteria 1594
42 Ga0466719_272787 3300042606 Bacteria 1443
43 DPOL_contig15320 2035918003 Unclassified 22631
44 FGTW_contig24621 2065487013 Unclassified 1717
45 Ga0103265_1001058 3300007068 Bacteria 4513
46 Ga0102739_1000253 3300007095 Bacteria 12753
47 Ga0102737_1001709 3300007142 Unclassified 5899
48 Ga0103264_1000714 3300007188 Bacteria 17183
49 Ga0103264_1011345 3300007188 Bacteria 4360
50 Ga0123356_10171840 3300010049 Unclassified 2179
51 Ga0160452_114166 3300012834 Bacteria 901
52 Ga0466657_173665 3300042582 Bacteria 8654
53 Ga0466691_013067 3300042593 Bacteria 10969
54 Ga0466705_051876 3300042612 Bacteria 5181
55 Ga0466715_006019 3300042616 Bacteria 9870
56 Ga0466725_004585 3300042654 Bacteria 10342
57 Ga0466719_201747 3300042606 Bacteria 1665
58 DPO_contig09084 2032320009 Bacteria 20549
59 DPOL_contig05623 2035918003 Unclassified 5409
60 Ga0103260_1001222 3300007139 Bacteria 4667
61 Ga0102738_1000332 3300007141 Bacteria 8553
62 Ga0160465_103607 3300012803 Bacteria 2718
63 Ga0160432_100173 3300012818 Bacteria 57982
64 Ga0466704_252776 3300042643 Unclassified 14787
65 Ga0466727_290783 3300042655 Bacteria 3361
66 Ga0466716_413680 3300042605 Bacteria 1570
67 CVPL005W_1000775 3300002934 Unclassified 11142
68 Ga0103263_106305 3300007042 Bacteria 1308
69 Ga0103266_1001283 3300007067 Bacteria 6605
70 Ga0102734_1001251 3300007129 Bacteria 11294
71 Ga0102740_1000558 3300007140 Unclassified 10209
72 Ga0123357_10000011 3300009784 Bacteria 173575
73 Ga0123355_10114715 3300009826 Unclassified 4198
74 Ga0466696_285415 3300042596 Bacteria 2195
75 Ga0466730_006076 3300042625 Bacteria 6051
76 Ga0466730_007502 3300042625 Bacteria 3021
77 Ga0466724_16515 3300042649 Bacteria 5448
78 Ga0466724_20732 3300042649 Bacteria 57865
79 DPO_contig00211 2032320009 Bacteria 7446
80 SWWA_contig02283__length_22774___numreads_1263 2100351016 Bacteria 22774
81 SWWA_contig11517__length_2185___numreads_47 2100351016 Bacteria 2185
82 Ga0160455_100850 3300012837 Bacteria 11749
83 Ga0160445_100091 3300012847 Bacteria 91619
84 Ga0466715_636250 3300042616 Bacteria 1156
85 Ga0466730_001789 3300042625 Bacteria 2801
86 Ga0466730_006684 3300042625 Bacteria 2903
87 Ga0466703_113070 3300042636 Bacteria 3213
88 Ga0466724_33559 3300042649 Bacteria 39633
89 Ga0466724_51767 3300042649 Bacteria 2373
90 Ga0466708_161197 3300042652 Bacteria 9466
91 Ga0466713_147102 3300042602 Bacteria 36015
92 CVPL010W_10018453 3300002931 Bacteria 5765
93 CVPL005W_1000122 3300002934 Bacteria 35925
94 Ga0103261_1000682 3300007083 Bacteria 5135
95 Ga0105005_1011036 3300007505 Bacteria 3277
96 Ga0562377_0395 3300056842 Bacteria 79456
97 Ga0160465_101867 3300012803 Unclassified 5356
98 Ga0160469_101080 3300012824 Bacteria 8358
99 Ga0466691_124305 3300042593 Bacteria 6357
100 Ga0466715_638547 3300042616 Bacteria 10318
101 Ga0466724_39783 3300042649 Bacteria 50074

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2065487013 FGTW_contig24621 FGTW_02311500 222
2 3300042643 Ga0466704_252776 Ga0466704_252776_765_1433 222
3 3300042625 Ga0466730_006076 Ga0466730_006076_3147_3878 243
4 3300042649 Ga0466724_58698 Ga0466724_58698_97359_98090 243
5 3300056842 Ga0562377_0395 Ga0562377_0395_716_1471 243
6 iso_pr_bacteria 3006190525 3006192713 243
7 3300005309 Ga0074306_1121754 Ga0074306_11217541 244
8 3300007150 Ga0104019_1191910 Ga0104019_11919102 244
9 3300042649 Ga0466724_16515 Ga0466724_16515_3657_4391 244
10 3300042649 Ga0466724_19171 Ga0466724_19171_324_1058 244
11 3300002931 CVPL010W_10018453 CVPL010W_100184537 246
12 3300002934 CVPL005W_1000775 CVPL005W_10007757 246
13 3300007080 Ga0102735_1000560 Ga0102735_10005601 246
14 3300007141 Ga0102738_1000332 Ga0102738_10003324 246
15 3300007188 Ga0103264_1011345 Ga0103264_10113454 246
16 3300007042 Ga0103263_106305 Ga0103263_1063052 248
17 3300007067 Ga0103266_1000009 Ga0103266_100000965 248
18 3300007068 Ga0103265_1001058 Ga0103265_10010583 248
19 3300042615 Ga0466711_393167 Ga0466711_393167_2424_3194 248
20 3300007095 Ga0102739_1000253 Ga0102739_10002539 251
21 3300007153 Ga0104050_1002187 Ga0104050_100218716 251
22 3300042602 Ga0466713_147102 Ga0466713_147102_6573_7328 251
23 iso_pr_bacteria 2519899623 2520394914 251
24 iso_pr_bacteria 2537561600 2537926495 251
25 iso_pr_bacteria 2778261152 2779040755 251
26 iso_pr_bacteria 2778261153 2779041317 251
27 iso_pr_bacteria 2871760914 2871761301 251
28 iso_pr_bacteria 2938192669 2938196174 251
29 iso_pr_bacteria 8071322446 8071326207 251
30 iso_pr_bacteria 8071333649 8071338287 251
31 iso_pr_bacteria 8071338694 8071342385 251
32 iso_pr_bacteria 8073124432 8073127092 251
33 3300005320 Ga0074317_1038350 Ga0074317_10383502 252
34 iso_pr_bacteria 2630968716 2632955358 252
35 iso_pr_bacteria 2844251356 2844253386 252
36 iso_pr_bacteria 2868883784 2868885973 252
37 iso_pr_bacteria 2900349738 2900350500 252
38 iso_pr_bacteria 2902438364 2902439556 252
39 iso_pr_bacteria 2902451016 2902453248 252
40 iso_pr_bacteria 2902469402 2902472652 252
41 iso_pr_bacteria 8116627632 8116632377 252
42 3300042606 Ga0466719_272288 Ga0466719_272288_1848_2609 253
43 3300042612 Ga0466705_051876 Ga0466705_051876_370_1131 253
44 iso_pr_bacteria 2617270844 2617733045 253
45 3300042591 Ga0466692_094430 Ga0466692_094430_24365_25129 254
46 3300042593 Ga0466691_013067 Ga0466691_013067_4425_5189 254
47 3300042593 Ga0466691_124305 Ga0466691_124305_2823_3587 254
48 3300042605 Ga0466716_182145 Ga0466716_182145_5362_6126 254
49 3300042616 Ga0466715_006019 Ga0466715_006019_8574_9338 254
50 3300042616 Ga0466715_636250 Ga0466715_636250_140_904 254
51 3300042619 Ga0466726_005840 Ga0466726_005840_1139_1903 254
52 3300042619 Ga0466726_091316 Ga0466726_091316_1189_1953 254
53 3300042621 Ga0466729_246494 Ga0466729_246494_128_892 254
54 3300042636 Ga0466703_113070 Ga0466703_113070_1967_2731 254
55 3300042643 Ga0466704_028879 Ga0466704_028879_3509_4273 254
56 3300042648 Ga0466709_245063 Ga0466709_245063_1645_2409 254
57 3300042655 Ga0466727_290783 Ga0466727_290783_2259_3023 254
58 iso_pr_bacteria 2838140227 2838140305 254
59 iso_pr_bacteria 8102033761 8102040460 254
60 2032320009 DPO_contig00211 DPOB_245190 255
61 2032320009 DPO_contig09084 DPOB_66990 255
62 2035918003 DPOL_contig15320 DPOLB_2089440 255
63 2044078006 SPBB_contig01219 SPBB_803660 255
64 2044078006 SPBB_contig11512 SPBB_295180 255
65 3300007129 Ga0102734_1001251 Ga0102734_100125111 255
66 3300042596 Ga0466696_285415 Ga0466696_285415_490_1257 255
67 3300042598 Ga0466701_097121 Ga0466701_097121_43190_43957 255
68 3300042654 Ga0466725_064713 Ga0466725_064713_126_893 255
69 iso_pr_bacteria 2519899622 2520389529 255
70 iso_pr_bacteria 2571042003 2571062809 255
71 iso_pr_bacteria 2603880173 2606038094 255
72 iso_pr_bacteria 2687453754 2690040333 255
73 iso_pr_bacteria 2687453755 2690044302 255
74 iso_pr_bacteria 2687453756 2690048060 255
75 iso_pr_bacteria 2820115951 2820119084 255
76 iso_pr_bacteria 2820123897 2820125034 255
77 iso_pr_bacteria 2864745180 2864748725 255
78 iso_pr_bacteria 2864853652 2864857264 255
79 iso_pr_bacteria 8035321120 8035325819 255
80 iso_pr_bacteria 8035326735 8035329388 255
81 3300002464 Meta3P_1011862 Meta3P_10118625 256
82 3300002934 CVPL005W_1000122 CVPL005W_100012216 256
83 3300007067 Ga0103266_1001283 Ga0103266_10012834 256
84 3300007068 Ga0103265_1000268 Ga0103265_10002686 256
85 3300007083 Ga0103261_1000682 Ga0103261_10006822 256
86 3300007139 Ga0103260_1001222 Ga0103260_10012223 256
87 3300007140 Ga0102740_1000558 Ga0102740_10005589 256
88 3300007142 Ga0102737_1001709 Ga0102737_10017093 256
89 3300007188 Ga0103264_1000389 Ga0103264_10003894 256
90 3300007188 Ga0103264_1000714 Ga0103264_10007146 256
91 3300007192 Ga0103268_1000004 Ga0103268_100000424 256
92 3300007505 Ga0105005_1011036 Ga0105005_10110366 256
93 3300009784 Ga0123357_10000011 Ga0123357_1000001176 256
94 3300009784 Ga0123357_10002169 Ga0123357_1000216915 256
95 3300010882 Ga0123354_10213096 Ga0123354_102130962 256
96 3300012813 Ga0160470_100031 Ga0160470_10003128 256
97 3300012818 Ga0160432_100173 Ga0160432_1001738 256
98 3300012829 Ga0160467_102249 Ga0160467_1022491 256
99 3300012834 Ga0160452_114166 Ga0160452_1141661 256
100 3300012839 Ga0160472_100510 Ga0160472_1005109 256
101 3300012847 Ga0160445_100091 Ga0160445_10009177 256
102 3300012848 Ga0160443_115043 Ga0160443_1150431 256
103 3300042654 Ga0466725_004585 Ga0466725_004585_6007_6777 256
104 iso_pr_bacteria 2820148564 2820149633 256
105 iso_pr_bacteria 2889908211 2889912879 256
106 3300009826 Ga0123355_10114715 Ga0123355_101147154 257
107 3300010049 Ga0123356_10171840 Ga0123356_101718402 257
108 iso_pr_bacteria 2902896024 2902899269 257
109 3300042605 Ga0466716_413680 Ga0466716_413680_453_1229 258
110 3300042606 Ga0466719_201747 Ga0466719_201747_195_971 258
111 3300042613 Ga0466710_319477 Ga0466710_319477_430_1206 258
112 iso_pr_bacteria 2510065001 2510069547 258
113 iso_pr_bacteria 2772190787 2773011472 258
114 iso_pr_bacteria 2773858019 2775252158 258
115 iso_pr_bacteria 2864903489 2864905447 258
116 iso_pr_bacteria 646564517 646764217 258
117 2035918003 DPOL_contig05623 DPOLB_237990 259
118 2065487013 FGTW_contig30567 FGTW_01585230 259
119 2100351016 SWWA_contig11517__length_2185___numreads_47 SWWA_01469030 259
120 3300012803 Ga0160465_101867 Ga0160465_1018675 259
121 3300012824 Ga0160469_101080 Ga0160469_1010809 259
122 3300042598 Ga0466701_103385 Ga0466701_103385_17115_17894 259
123 3300042606 Ga0466719_272787 Ga0466719_272787_196_975 259
124 3300042619 Ga0466726_016069 Ga0466726_016069_973_1752 259
125 3300042625 Ga0466730_001789 Ga0466730_001789_131_910 259
126 3300042625 Ga0466730_006684 Ga0466730_006684_116_895 259
127 3300042649 Ga0466724_20732 Ga0466724_20732_37923_38702 259
128 3300042649 Ga0466724_33559 Ga0466724_33559_18945_19724 259
129 3300042649 Ga0466724_39783 Ga0466724_39783_38191_38970 259
130 iso_pr_bacteria 2681813507 2684383604 259
131 iso_pr_bacteria 2864739902 2864740671 259
132 iso_pr_bacteria 2864751016 2864752421 259
133 iso_pr_bacteria 2864847319 2864848418 259
134 iso_pr_bacteria 2864926767 2864930212 259
135 iso_pr_bacteria 2987233858 2987233990 259
136 iso_pr_bacteria 2990166910 2990167018 259
137 iso_pr_bacteria 3007473699 3007473971 259
138 iso_pr_bacteria 3007478678 3007483714 259
139 iso_pr_bacteria 637000219 638002502 259
140 iso_pr_bacteria 8011329375 8011332588 259
141 iso_pr_bacteria 8011357093 8011359678 259
142 iso_pr_bacteria 8035422605 8035426328 259
143 iso_pr_bacteria 8052469819 8052475903 259
144 3300007103 Ga0104049_1131990 Ga0104049_11319901 260
145 3300012803 Ga0160465_103607 Ga0160465_1036073 260
146 3300012828 Ga0160431_104286 Ga0160431_1042863 260
147 3300012846 Ga0160433_100129 Ga0160433_10012928 260
148 iso_pr_bacteria 2524614573 2524997784 260
149 3300042652 Ga0466708_161197 Ga0466708_161197_3172_3957 261
150 iso_pr_bacteria 2870361953 2870364773 262
151 3300042582 Ga0466657_173665 Ga0466657_173665_6952_7743 263
152 3300042623 Ga0466734_038905 Ga0466734_038905_1994_2785 263
153 3300042625 Ga0466730_038135 Ga0466730_038135_123_917 264
154 3300012837 Ga0160455_100850 Ga0160455_1008502 265
155 iso_pr_bacteria 2864968865 2864971101 267
156 3300042625 Ga0466730_007502 Ga0466730_007502_1184_1990 268
157 3300042616 Ga0466715_638547 Ga0466715_638547_8115_8927 270
158 3300012857 Ga0160435_1001456 Ga0160435_10014565 272
159 iso_pr_bacteria 2997878596 2997881639 278
160 3300042649 Ga0466724_51767 Ga0466724_51767_25_867 280
161 2100351016 SWWA_contig02283__length_22774___numreads_1263 SWWA_00648890 305

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus 218 305 0.96
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 60 209 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.