Protein Family IF00068
Metagenome
Isolate
300
Members
231
Samples
89
Scaffolds
438.57
Avg Length
Representative Sequence
- ID
- 2100351016|SWWA_contig01906__length_2996___numreads_58|SWWA_02857180
- Length
- 478 aa
- Sequence
- VRLGCLFGAATIGHAGNRVGRYATTLSDNFFSFEQATRHRMSHRLTSKDILALGFMTFALFVGAGNIIFPPMVGLQSGEHVWTAALGFLITAVGLPVITVIALARVGGGIDALSSPIGRGAGLLLATVCYLAVGPLFATPRTATVSFEVGIAPLTGDGAMPLFIYSLVYFALVIGISLYPGRLLDTVGHVLAPLKIVALAVLGIAALLWPAGAPIPATAAYQSVPFSSGFVNGYLTMDTLGALVFGIVIVNAARSRGVKDAGLLTRYTILAGLIAGVGLTLVYLSLFKLGSGSGALVPDATNGAVILHAYVQNTFGGLGSFFLAALIFIACMVTAVGLTCACAEFFAQYLPFSYKTLVFILGLFSMVVSNLGLSHLIQISIPVLTAIYPPCIVLVVLSFTLRWWHSAPRIIAPVMLVSLLFGILDAVKASSFQQLLPAWTTHLPLAEQGLAWLPPSLLMLVLVAIYDRVCTRSQVTAH
Sample Types
Isolate
70.3%
Metagenome
29.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
14.7%
Anthocoridae
9.7%
Drosophilidae
9.7%
Curculionidae
8.3%
Culicidae
6.0%
Muscidae
6.0%
Aphididae
5.1%
Tenebrionidae
5.1%
Elmidae
4.6%
Calliphoridae
4.1%
Apidae
2.3%
Tephritidae
2.3%
Armadillidiidae
2.3%
Termitidae
2.3%
Cerambycidae
1.8%
Pteromalidae
1.4%
Sarcophagidae
0.9%
Kalotermitidae
0.9%
Aleyrodidae
0.9%
Pentatomidae
0.9%
Formicidae
0.9%
Scarabaeidae
0.5%
Ceratophyllidae
0.5%
Trigoniulidae
0.5%
Plutellidae
0.5%
Vespidae
0.5%
Daphniidae
0.5%
Aphrophoridae
0.5%
Stratiomyidae
0.5%
Gryllidae
0.5%
Thripidae
0.5%
Anthomyiidae
0.5%
Hippoboscidae
0.5%
Pediculidae
0.5%
Siricidae
0.5%
Passalidae
0.5%
Crambidae
0.5%
Noctuidae
0.5%
Rhopalidae
0.5%
Reduviidae
0.5%
Glossinidae
0.5%
Carabidae
0.5%
Taxonomy
Archaea
0
Bacteria
263
Eukaryota
0
Viruses
0
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 2 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 3 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 4 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 5 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 6 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 7 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 8 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 9 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 10 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 11 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 12 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 13 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 14 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 15 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 16 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 17 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 18 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 21 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 22 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 23 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 24 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 25 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 26 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 27 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 28 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 29 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 30 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 31 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 32 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 33 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 34 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 35 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 36 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 37 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 38 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 39 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 40 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 41 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 42 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 43 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 44 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 45 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 46 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 47 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 48 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 49 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 50 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 51 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 54 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 55 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 56 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 57 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 58 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 59 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 60 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 61 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 62 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 63 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 64 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 65 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 66 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 67 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 68 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 69 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 70 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 71 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 72 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 73 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 74 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 75 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 76 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 77 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 78 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 79 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 80 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 81 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 82 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 83 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 84 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 85 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 86 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 87 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 88 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 89 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 90 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 91 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 92 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 93 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 94 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 95 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 96 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 97 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 98 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 99 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 100 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 101 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 102 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 103 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 104 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 105 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 106 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 107 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 108 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 109 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 110 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 111 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 112 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 113 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 114 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 115 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 116 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 117 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 118 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 119 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 120 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 121 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 122 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 123 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 124 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 125 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 126 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 127 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 128 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 129 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 130 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 131 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 132 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 133 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 134 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 135 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 136 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 137 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 138 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 139 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 140 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 141 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 142 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 143 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 144 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 145 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 146 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 147 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 148 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 149 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 150 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 151 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 152 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 153 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 154 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 155 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 156 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 157 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 158 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 159 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 160 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 161 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 162 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 163 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 164 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 165 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 166 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 167 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 168 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 169 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 170 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 171 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 172 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 173 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 174 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 175 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 176 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 177 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 178 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 179 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 180 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 181 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 182 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 183 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 184 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 185 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 186 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 187 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 188 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 189 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 190 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 191 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 192 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 193 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 194 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 195 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 196 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 197 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 198 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 199 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 200 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 201 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 202 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 203 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 204 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 205 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 206 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 207 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 208 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 209 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 210 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 211 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 212 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 213 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 214 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 215 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 216 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 217 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 218 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 219 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 220 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 221 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 222 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 223 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 224 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 225 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 226 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 227 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 228 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 229 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 230 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 231 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_140209 | 3300042602 | Unclassified | 7159 |
| 2 | Ga0160472_100022 | 3300012839 | Bacteria | 329165 |
| 3 | Ga0160444_100917 | 3300012841 | Unclassified | 7719 |
| 4 | Ga0160433_100129 | 3300012846 | Bacteria | 68423 |
| 5 | Ga0160447_104656 | 3300012849 | Unclassified | 4009 |
| 6 | Ga0265387_1000023 | 3300024582 | Bacteria | 64853 |
| 7 | WW0001_100081 | 3300002732 | Bacteria | 214513 |
| 8 | Ga0063521_1000020 | 3300003973 | Bacteria | 138309 |
| 9 | Ga0063521_1000034 | 3300003973 | Bacteria | 116714 |
| 10 | Ga0105553_1034195 | 3300007767 | Unclassified | 28645 |
| 11 | Ga0127657_102231 | 3300009457 | Bacteria | 61277 |
| 12 | Ga0127645_125032 | 3300009461 | Unclassified | 5031 |
| 13 | Ga0466730_002459 | 3300042625 | Bacteria | 11975 |
| 14 | Ga0466730_002517 | 3300042625 | Unclassified | 13401 |
| 15 | Ga0466724_32342 | 3300042649 | Unclassified | 12113 |
| 16 | Ga0466724_60250 | 3300042649 | Unclassified | 4245 |
| 17 | Ga0466701_084094 | 3300042598 | Bacteria | 199179 |
| 18 | Ga0160469_101486 | 3300012824 | Unclassified | 6092 |
| 19 | Ga0160472_101743 | 3300012839 | Unclassified | 5736 |
| 20 | Ga0265387_1000155 | 3300024582 | Bacteria | 12611 |
| 21 | Ga0104050_1026993 | 3300007153 | Bacteria | 2388 |
| 22 | Ga0530661_000913 | 3300056564 | Unclassified | 17845 |
| 23 | Ga0466730_009810 | 3300042625 | Bacteria | 79781 |
| 24 | Ga0466730_100474 | 3300042625 | Bacteria | 12884 |
| 25 | Ga0160448_103304 | 3300012854 | Bacteria | 4762 |
| 26 | DPOL_contig13426 | 2035918003 | Unclassified | 3639 |
| 27 | SWWA_contig31808__length_5865___numreads_290 | 2100351016 | Bacteria | 5865 |
| 28 | 2227080800 | 2225789004 | Bacteria | 41183 |
| 29 | Ga0063521_1000013 | 3300003973 | Bacteria | 168262 |
| 30 | Ga0104040_1041306 | 3300007149 | Bacteria | 5942 |
| 31 | Ga0466730_032399 | 3300042625 | Unclassified | 10317 |
| 32 | Ga0466709_084170 | 3300042648 | Bacteria | 6432 |
| 33 | Ga0466724_29726 | 3300042649 | Bacteria | 169575 |
| 34 | Ga0316159_10058 | 3300030930 | Bacteria | 19200 |
| 35 | Ga0466701_013369 | 3300042598 | Bacteria | 26761 |
| 36 | HBC_ctgsDRAFT_1002749 | 3300000333 | Bacteria | 3996 |
| 37 | Ga0104041_1001774 | 3300007106 | Bacteria | 8271 |
| 38 | Ga0466724_25048 | 3300042649 | Unclassified | 4237 |
| 39 | Ga0466724_38169 | 3300042649 | Bacteria | 71039 |
| 40 | Ga0466701_015808 | 3300042598 | Bacteria | 25220 |
| 41 | Ga0466707_309270 | 3300042601 | Bacteria | 5413 |
| 42 | Ga0466713_150007 | 3300042602 | Bacteria | 123521 |
| 43 | Ga0160453_101886 | 3300012814 | Unclassified | 6062 |
| 44 | Ga0160441_101709 | 3300012825 | Unclassified | 5823 |
| 45 | Ga0160431_100097 | 3300012828 | Bacteria | 68692 |
| 46 | SWWA_contig01906__length_2996___numreads_58 | 2100351016 | Bacteria | 2996 |
| 47 | Meta3P_1000754 | 3300002464 | Bacteria | 12000 |
| 48 | Meta3P_1001785 | 3300002464 | Unclassified | 11803 |
| 49 | CVPL010L_1000556 | 3300002932 | Unclassified | 7681 |
| 50 | Ga0562379_0710 | 3300056790 | Bacteria | 56090 |
| 51 | Ga0466730_029593 | 3300042625 | Unclassified | 4581 |
| 52 | Ga0466724_25559 | 3300042649 | Bacteria | 176427 |
| 53 | Ga0466724_40205 | 3300042649 | Bacteria | 12694 |
| 54 | Ga0160466_102181 | 3300012809 | Unclassified | 4138 |
| 55 | Ga0466701_007859 | 3300042598 | Bacteria | 109470 |
| 56 | DPOL_contig13333 | 2035918003 | Unclassified | 16905 |
| 57 | FGTW_contig30454 | 2065487013 | Bacteria | 28667 |
| 58 | Ga0063521_1000060 | 3300003973 | Bacteria | 95522 |
| 59 | Ga0063521_1001972 | 3300003973 | Unclassified | 5210 |
| 60 | Ga0105005_1090718 | 3300007505 | Unclassified | 6677 |
| 61 | Ga0562375_0007 | 3300056856 | Bacteria | 1880046 |
| 62 | Ga0136159_1000066 | 3300010217 | Bacteria | 97058 |
| 63 | Ga0160466_100164 | 3300012809 | Bacteria | 52842 |
| 64 | Ga0466713_085938 | 3300042602 | Bacteria | 3243 |
| 65 | Ga0160470_100651 | 3300012813 | Unclassified | 11687 |
| 66 | Ga0160455_102232 | 3300012837 | Bacteria | 4261 |
| 67 | Ga0247290_02094 | 3300035364 | Unclassified | 1927 |
| 68 | 2227535715 | 2225789004 | Bacteria | 63142 |
| 69 | Meta3P_1000412 | 3300002464 | Bacteria | 36334 |
| 70 | Ga0105005_1009735 | 3300007505 | Bacteria | 2578 |
| 71 | Ga0105005_1043213 | 3300007505 | Unclassified | 2735 |
| 72 | Ga0127656_100815 | 3300009453 | Unclassified | 38674 |
| 73 | Ga0466730_052249 | 3300042625 | Unclassified | 3463 |
| 74 | Ga0466724_07498 | 3300042649 | Bacteria | 10222 |
| 75 | Ga0466724_28653 | 3300042649 | Unclassified | 11355 |
| 76 | Ga0466713_040227 | 3300042602 | Bacteria | 18010 |
| 77 | Ga0160467_102305 | 3300012829 | Unclassified | 4465 |
| 78 | Ga0160436_1007972 | 3300012861 | Unclassified | 2401 |
| 79 | DPO_contig07395 | 2032320009 | Unclassified | 12552 |
| 80 | DPOL_contig00174 | 2035918003 | Unclassified | 14207 |
| 81 | SPBB_contig00348 | 2044078006 | Bacteria | 37454 |
| 82 | SPBB_contig11656 | 2044078006 | Unclassified | 5929 |
| 83 | FGTW_contig30482 | 2065487013 | Bacteria | 23493 |
| 84 | Ga0063521_1000916 | 3300003973 | Unclassified | 9747 |
| 85 | Ga0074188_1043090 | 3300005318 | Bacteria | 5208 |
| 86 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 87 | Ga0562376_2458 | 3300056857 | Unclassified | 21975 |
| 88 | Ga0466730_069675 | 3300042625 | Bacteria | 9907 |
| 89 | Ga0466724_22127 | 3300042649 | Unclassified | 11804 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05525 | Branch_AA_trans | Branched-chain amino acid transport protein | 47 | 468 | 0.99 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6csf-assembly2.cif.gz_M | Crystal structure of sodium/alanine symporter AgcS with D-alanine bound | 0.687 | 31 | 401 |
| 8e6n-assembly1.cif.gz_A | X-ray structure of the Deinococcus radiodurans Nramp/MntH divalent transition metal transporter G223W mutant in an outward-open, manganese-bound state | 0.66 | 49 | 428 |
| 7qoa-assembly2.cif.gz_B | Structure of CodB, a cytosine transporter in an outward-facing conformation | 0.652 | 50 | 465 |
| 8e6m-assembly1.cif.gz_A | X-ray structure of the Deinococcus radiodurans Nramp/MntH divalent transition metal transporter WT in an inward-open, cadmium-bound state | 0.649 | 51 | 427 |
| 3p03-assembly1.cif.gz_C | Crystal structure of BetP-G153D with choline bound | 0.645 | 51 | 428 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AD99_6_430_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.996 | 46 | 469 | 1.20.1740.10 |
| af_Q2G171_2_420_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9457 | 58 | 470 | 1.20.1740.10 |
| af_Q2FYM4_4_445_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9431 | 53 | 469 | 1.20.1740.10 |
| af_Q2G1H2_6_444_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9378 | 46 | 469 | 1.20.1740.10 |
| af_Q2G0E6_5_354_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7372 | 49 | 402 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328XRA7-F1-model_v4 | Branched-chain amino acid transport system carrier protein | 0.9676 | 41 | 470 |
GO:0005886
GO:0015188 GO:0015190 GO:0005304 GO:0015818 GO:0015820 |
| AF-A0A378ATM5-F1-model_v4 | Branched-chain amino acid transport system carrier protein | 0.9658 | 73 | 309 |
GO:0005886
GO:0015188 GO:0015190 GO:0005304 GO:0015818 GO:0015820 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.