Protein Family IF00068

Metagenome Isolate
300 Members
231 Samples
89 Scaffolds
438.57 Avg Length

🧬 Representative Sequence

ID
2100351016|SWWA_contig01906__length_2996___numreads_58|SWWA_02857180
Length
478 aa
Sequence
VRLGCLFGAATIGHAGNRVGRYATTLSDNFFSFEQATRHRMSHRLTSKDILALGFMTFALFVGAGNIIFPPMVGLQSGEHVWTAALGFLITAVGLPVITVIALARVGGGIDALSSPIGRGAGLLLATVCYLAVGPLFATPRTATVSFEVGIAPLTGDGAMPLFIYSLVYFALVIGISLYPGRLLDTVGHVLAPLKIVALAVLGIAALLWPAGAPIPATAAYQSVPFSSGFVNGYLTMDTLGALVFGIVIVNAARSRGVKDAGLLTRYTILAGLIAGVGLTLVYLSLFKLGSGSGALVPDATNGAVILHAYVQNTFGGLGSFFLAALIFIACMVTAVGLTCACAEFFAQYLPFSYKTLVFILGLFSMVVSNLGLSHLIQISIPVLTAIYPPCIVLVVLSFTLRWWHSAPRIIAPVMLVSLLFGILDAVKASSFQQLLPAWTTHLPLAEQGLAWLPPSLLMLVLVAIYDRVCTRSQVTAH

📊 Sample Types

Isolate 70.3%
Metagenome 29.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 14.7%
Anthocoridae 9.7%
Drosophilidae 9.7%
Curculionidae 8.3%
Culicidae 6.0%
Muscidae 6.0%
Aphididae 5.1%
Tenebrionidae 5.1%
Elmidae 4.6%
Calliphoridae 4.1%
Apidae 2.3%
Tephritidae 2.3%
Armadillidiidae 2.3%
Termitidae 2.3%
Cerambycidae 1.8%
Pteromalidae 1.4%
Sarcophagidae 0.9%
Kalotermitidae 0.9%
Aleyrodidae 0.9%
Pentatomidae 0.9%
Formicidae 0.9%
Scarabaeidae 0.5%
Ceratophyllidae 0.5%
Trigoniulidae 0.5%
Plutellidae 0.5%
Vespidae 0.5%
Daphniidae 0.5%
Aphrophoridae 0.5%
Stratiomyidae 0.5%
Gryllidae 0.5%
Thripidae 0.5%
Anthomyiidae 0.5%
Hippoboscidae 0.5%
Pediculidae 0.5%
Siricidae 0.5%
Passalidae 0.5%
Crambidae 0.5%
Noctuidae 0.5%
Rhopalidae 0.5%
Reduviidae 0.5%
Glossinidae 0.5%
Carabidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 263
Eukaryota 0
Viruses 0
Unclassified 37

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2871771314 Pantoea sp. Ae16 Isolate Culicidae
2 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
3 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
4 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
5 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
6 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
7 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
8 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
9 2645727860 Winslowiella iniecta B120 Isolate Aphididae
10 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
11 2703719240 Serratia marcescens ano2 Isolate Unclassified
12 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
13 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
14 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
15 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
16 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
17 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
18 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 644736334 Candidatus Hamiltonella defensa 5AT Isolate Aphididae
21 648276708 Pantoea sp. aB Isolate Unclassified
22 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
23 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
24 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
25 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
26 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
27 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
28 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
29 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
30 2848317263 Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF Isolate Aleyrodidae
31 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
32 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
33 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
34 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
35 2898975184 Erwinia dacicola IL Isolate Tephritidae
36 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
37 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
38 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
39 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
40 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
41 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
42 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
43 2978161719 Serratia marcescens KZ2 Isolate Apidae
44 3000861951 Budvicia diplopodorum D9 Isolate
45 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
46 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
47 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
48 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
49 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
50 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
51 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
54 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
55 8018312681 Enterobacter sp. OLF Isolate Tephritidae
56 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
57 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
58 8076032775 Erwinia haradaeae ErCicurvipes/3402 Isolate Aphididae
59 8099192374 Erwinia typographi IC4 Isolate Curculionidae
60 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
61 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
62 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
63 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
64 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
65 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
66 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
67 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
68 2548876931 Candidatus Hamiltonella defensa MED (Bemisia tabaci) Isolate Aleyrodidae
69 2574179716 Serratia sp. DD3 Isolate Daphniidae
70 2585428135 Sodalis-like symbiont of Philaenus spumarius PSPU Isolate Aphrophoridae
71 2590828839 Clostridium sp. 1 Isolate Termitidae
72 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
73 2718217944 Serratia marcescens AS1 Isolate Culicidae
74 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
75 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
76 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
77 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
78 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
79 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
80 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
81 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
82 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
83 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
84 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
85 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
86 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
87 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
88 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
89 8076029003 Erwinia haradaeae ErCipiceae/3303 Isolate Aphididae
90 8076031238 Erwinia haradaeae ErCicurtihirsuta/3053 Isolate Aphididae
91 8100176769 Kosakonia sp. S57 Isolate Curculionidae
92 2836714267 Shimwellia blattae NCTC10965 Isolate
93 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
94 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
95 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
96 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
97 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
98 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
99 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
100 2593339124 Clostridium sp. 4 Isolate Termitidae
101 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
102 2971189173 Yersinia pestis A-1249 Isolate Unclassified
103 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
104 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
105 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
106 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
107 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
108 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
109 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
110 637000219 Pseudomonas entomophila L48 Isolate Unclassified
111 8021546568 Klebsiella sp. Kps Isolate Tephritidae
112 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
113 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
114 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
115 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
116 8071322446 Escherichia coli PN122 Isolate Calliphoridae
117 8100171289 Kosakonia sp. S42 Isolate Curculionidae
118 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
119 8103002986 Erwinia sp. S38 Isolate Curculionidae
120 8103008710 Erwinia sp. S43 Isolate Curculionidae
121 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
122 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
123 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
124 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
125 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
126 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
127 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
128 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
129 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
130 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
131 2510065004 Arsenophonus melophagi ArM Isolate Hippoboscidae
132 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
133 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
134 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
135 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
136 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
137 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
138 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
139 651324086 Plautia crossota stali symbiont Isolate Unclassified
140 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
141 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
142 8071333649 Escherichia coli PN108 Isolate Calliphoridae
143 8071338694 Escherichia coli PN87 Isolate Calliphoridae
144 8102982778 Erwinia sp. S63 Isolate Curculionidae
145 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
146 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
147 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
148 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
149 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
150 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
151 2937735258 Serratia marcescens KZ11 Isolate Apidae
152 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
153 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
154 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
155 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
156 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
157 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
158 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
159 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
160 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
161 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
162 2978102237 Serratia fonticola AeS1 Isolate Culicidae
163 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
164 3007994558 Escherichia alba B35 Isolate Tenebrionidae
165 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
166 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
167 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
168 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
169 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
170 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
171 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
172 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
173 8100181737 Kosakonia sp. S58 Isolate Curculionidae
174 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
175 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
176 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
177 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
178 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
179 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
180 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
181 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
182 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
183 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
184 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
185 2531839311 Acinetobacter sp. HA Isolate Noctuidae
186 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
187 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
188 2648501209 Winslowiella iniecta B149 Isolate Aphididae
189 2703719239 Serratia marcescens ano1 Isolate Unclassified
190 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
191 2811995301 Serratia symbiotica STs Pazieg Isolate Aphididae
192 2986970932 Candidatus Fukatsuia symbiotica 5D Isolate Unclassified
193 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
194 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
195 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
196 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
197 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
198 651285005 Serratia symbiotica Tuscon Isolate Aphididae
199 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
200 8004541719 Serratia marcescens KZ19 Isolate Apidae
201 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
202 8035422605 Pseudomonas monteilii CY06 Isolate
203 8076030444 Erwinia haradaeae ErCilaricifoliae/3058 Isolate Aphididae
204 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
205 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
206 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
207 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
208 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
209 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
210 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
211 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
212 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
213 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
214 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
215 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
216 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
217 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
218 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
219 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
220 3300010217 Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 Metagenome Aphididae
221 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
222 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
223 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
224 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
225 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
226 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
227 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
228 8052469819 Pseudomonas putida DZ-F23 Isolate
229 8071343737 Escherichia coli PN119 Isolate Calliphoridae
230 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
231 8101683685 Providencia sp. JGM181 Isolate Drosophilidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466713_140209 3300042602 Unclassified 7159
2 Ga0160472_100022 3300012839 Bacteria 329165
3 Ga0160444_100917 3300012841 Unclassified 7719
4 Ga0160433_100129 3300012846 Bacteria 68423
5 Ga0160447_104656 3300012849 Unclassified 4009
6 Ga0265387_1000023 3300024582 Bacteria 64853
7 WW0001_100081 3300002732 Bacteria 214513
8 Ga0063521_1000020 3300003973 Bacteria 138309
9 Ga0063521_1000034 3300003973 Bacteria 116714
10 Ga0105553_1034195 3300007767 Unclassified 28645
11 Ga0127657_102231 3300009457 Bacteria 61277
12 Ga0127645_125032 3300009461 Unclassified 5031
13 Ga0466730_002459 3300042625 Bacteria 11975
14 Ga0466730_002517 3300042625 Unclassified 13401
15 Ga0466724_32342 3300042649 Unclassified 12113
16 Ga0466724_60250 3300042649 Unclassified 4245
17 Ga0466701_084094 3300042598 Bacteria 199179
18 Ga0160469_101486 3300012824 Unclassified 6092
19 Ga0160472_101743 3300012839 Unclassified 5736
20 Ga0265387_1000155 3300024582 Bacteria 12611
21 Ga0104050_1026993 3300007153 Bacteria 2388
22 Ga0530661_000913 3300056564 Unclassified 17845
23 Ga0466730_009810 3300042625 Bacteria 79781
24 Ga0466730_100474 3300042625 Bacteria 12884
25 Ga0160448_103304 3300012854 Bacteria 4762
26 DPOL_contig13426 2035918003 Unclassified 3639
27 SWWA_contig31808__length_5865___numreads_290 2100351016 Bacteria 5865
28 2227080800 2225789004 Bacteria 41183
29 Ga0063521_1000013 3300003973 Bacteria 168262
30 Ga0104040_1041306 3300007149 Bacteria 5942
31 Ga0466730_032399 3300042625 Unclassified 10317
32 Ga0466709_084170 3300042648 Bacteria 6432
33 Ga0466724_29726 3300042649 Bacteria 169575
34 Ga0316159_10058 3300030930 Bacteria 19200
35 Ga0466701_013369 3300042598 Bacteria 26761
36 HBC_ctgsDRAFT_1002749 3300000333 Bacteria 3996
37 Ga0104041_1001774 3300007106 Bacteria 8271
38 Ga0466724_25048 3300042649 Unclassified 4237
39 Ga0466724_38169 3300042649 Bacteria 71039
40 Ga0466701_015808 3300042598 Bacteria 25220
41 Ga0466707_309270 3300042601 Bacteria 5413
42 Ga0466713_150007 3300042602 Bacteria 123521
43 Ga0160453_101886 3300012814 Unclassified 6062
44 Ga0160441_101709 3300012825 Unclassified 5823
45 Ga0160431_100097 3300012828 Bacteria 68692
46 SWWA_contig01906__length_2996___numreads_58 2100351016 Bacteria 2996
47 Meta3P_1000754 3300002464 Bacteria 12000
48 Meta3P_1001785 3300002464 Unclassified 11803
49 CVPL010L_1000556 3300002932 Unclassified 7681
50 Ga0562379_0710 3300056790 Bacteria 56090
51 Ga0466730_029593 3300042625 Unclassified 4581
52 Ga0466724_25559 3300042649 Bacteria 176427
53 Ga0466724_40205 3300042649 Bacteria 12694
54 Ga0160466_102181 3300012809 Unclassified 4138
55 Ga0466701_007859 3300042598 Bacteria 109470
56 DPOL_contig13333 2035918003 Unclassified 16905
57 FGTW_contig30454 2065487013 Bacteria 28667
58 Ga0063521_1000060 3300003973 Bacteria 95522
59 Ga0063521_1001972 3300003973 Unclassified 5210
60 Ga0105005_1090718 3300007505 Unclassified 6677
61 Ga0562375_0007 3300056856 Bacteria 1880046
62 Ga0136159_1000066 3300010217 Bacteria 97058
63 Ga0160466_100164 3300012809 Bacteria 52842
64 Ga0466713_085938 3300042602 Bacteria 3243
65 Ga0160470_100651 3300012813 Unclassified 11687
66 Ga0160455_102232 3300012837 Bacteria 4261
67 Ga0247290_02094 3300035364 Unclassified 1927
68 2227535715 2225789004 Bacteria 63142
69 Meta3P_1000412 3300002464 Bacteria 36334
70 Ga0105005_1009735 3300007505 Bacteria 2578
71 Ga0105005_1043213 3300007505 Unclassified 2735
72 Ga0127656_100815 3300009453 Unclassified 38674
73 Ga0466730_052249 3300042625 Unclassified 3463
74 Ga0466724_07498 3300042649 Bacteria 10222
75 Ga0466724_28653 3300042649 Unclassified 11355
76 Ga0466713_040227 3300042602 Bacteria 18010
77 Ga0160467_102305 3300012829 Unclassified 4465
78 Ga0160436_1007972 3300012861 Unclassified 2401
79 DPO_contig07395 2032320009 Unclassified 12552
80 DPOL_contig00174 2035918003 Unclassified 14207
81 SPBB_contig00348 2044078006 Bacteria 37454
82 SPBB_contig11656 2044078006 Unclassified 5929
83 FGTW_contig30482 2065487013 Bacteria 23493
84 Ga0063521_1000916 3300003973 Unclassified 9747
85 Ga0074188_1043090 3300005318 Bacteria 5208
86 Ga0562377_0016 3300056842 Bacteria 1202354
87 Ga0562376_2458 3300056857 Unclassified 21975
88 Ga0466730_069675 3300042625 Bacteria 9907
89 Ga0466724_22127 3300042649 Unclassified 11804

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 8035321120 8035323236 388
2 3300000333 HBC_ctgsDRAFT_1002749 HBC_ctgsDRAFT_10027492 389
3 iso_pr_bacteria 2731957969 2734004453 392
4 3300007505 Ga0105005_1043213 Ga0105005_10432132 397
5 3300035364 Ga0247290_02094 Ga0247290_02094_14_1240 408
6 3300042598 Ga0466701_084094 Ga0466701_084094_78236_79528 410
7 3300030930 Ga0316159_10058 Ga0316159_100584 413
8 3300042625 Ga0466730_029593 Ga0466730_029593_960_2273 414
9 3300009457 Ga0127657_102231 Ga0127657_1022319 415
10 iso_pr_bacteria 8035326735 8035328394 419
11 3300042625 Ga0466730_032399 Ga0466730_032399_8098_9399 420
12 3300042649 Ga0466724_25559 Ga0466724_25559_84061_85362 420
13 3300042649 Ga0466724_40205 Ga0466724_40205_108_1400 422
14 3300012825 Ga0160441_101709 Ga0160441_1017092 425
15 iso_pr_bacteria 2531839311 2533039068 428
16 iso_pr_bacteria 2864777284 2864779168 428
17 iso_pr_bacteria 2864796242 2864798222 428
18 iso_pr_bacteria 2864874997 2864876663 428
19 iso_pr_bacteria 2864973726 2864976262 428
20 iso_pr_bacteria 8021899934 8021902623 428
21 iso_pr_bacteria 8076032775 8076033339 431
22 iso_pr_bacteria 8100176769 8100181526 431
23 iso_pr_bacteria 8100181737 8100184964 431
24 iso_pr_bacteria 2585428135 2588035941 432
25 iso_pr_bacteria 8076031238 8076031804 432
26 3300042648 Ga0466709_084170 Ga0466709_084170_3842_5143 433
27 iso_pr_bacteria 2864751016 2864754702 433
28 iso_pr_bacteria 3006190525 3006191916 433
29 iso_pr_bacteria 641522603 641584399 433
30 3300042598 Ga0466701_015808 Ga0466701_015808_3310_4617 435
31 3300009461 Ga0127645_125032 Ga0127645_1250322 436
32 iso_pr_bacteria 2510065002 2510070177 436
33 iso_pr_bacteria 2510065003 2510075265 436
34 iso_pr_bacteria 2524614872 2526111085 436
35 iso_pr_bacteria 2744054871 2745950551 436
36 iso_pr_bacteria 2824588292 2824589308 436
37 iso_pr_bacteria 2836755666 2836759344 436
38 iso_pr_bacteria 2848317263 2848321382 436
39 2032320009 DPO_contig07395 DPOB_205790 437
40 2035918003 DPOL_contig13426 DPOLB_1050250 437
41 2044078006 SPBB_contig00348 SPBB_138130 437
42 2044078006 SPBB_contig11656 SPBB_704640 437
43 2065487013 FGTW_contig30454 FGTW_00680650 437
44 2100351016 SWWA_contig31808__length_5865___numreads_290 SWWA_02509580 437
45 3300042598 Ga0466701_013369 Ga0466701_013369_3240_4553 437
46 3300042649 Ga0466724_22127 Ga0466724_22127_9147_10460 437
47 3300042649 Ga0466724_28653 Ga0466724_28653_8641_9954 437
48 3300042649 Ga0466724_32342 Ga0466724_32342_9481_10794 437
49 iso_pr_bacteria 2519899622 2520388686 437
50 iso_pr_bacteria 2822856742 2822858810 437
51 iso_pr_bacteria 2864739902 2864744645 437
52 iso_pr_bacteria 2864745180 2864748037 437
53 iso_pr_bacteria 2864853652 2864857524 437
54 iso_pr_bacteria 2864903489 2864909093 437
55 iso_pr_bacteria 2864926767 2864932098 437
56 iso_pr_bacteria 2997878596 2997880636 437
57 iso_pr_bacteria 3007473699 3007474022 437
58 iso_pr_bacteria 3007478678 3007479107 437
59 iso_pr_bacteria 637000219 638002569 437
60 iso_pr_bacteria 8001059720 8001060293 437
61 iso_pr_bacteria 8011329375 8011331999 437
62 iso_pr_bacteria 8035422605 8035424765 437
63 iso_pr_bacteria 8052469819 8052472059 437
64 iso_pr_bacteria 8102982778 8102986489 437
65 iso_pr_bacteria 8110023836 8110027535 437
66 3300005318 Ga0074188_1043090 Ga0074188_10430902 438
67 3300012809 Ga0160466_100164 Ga0160466_10016452 438
68 3300012809 Ga0160466_102181 Ga0160466_1021815 438
69 3300012813 Ga0160470_100651 Ga0160470_1006512 438
70 3300012814 Ga0160453_101886 Ga0160453_1018862 438
71 3300012824 Ga0160469_101486 Ga0160469_1014862 438
72 3300012829 Ga0160467_102305 Ga0160467_1023056 438
73 3300012839 Ga0160472_101743 Ga0160472_1017432 438
74 3300012841 Ga0160444_100917 Ga0160444_1009172 438
75 3300012846 Ga0160433_100129 Ga0160433_1001292 438
76 3300012849 Ga0160447_104656 Ga0160447_1046562 438
77 3300012861 Ga0160436_1007972 Ga0160436_10079723 438
78 3300042649 Ga0466724_25048 Ga0466724_25048_137_1453 438
79 3300056564 Ga0530661_000913 Ga0530661_000913_876_2192 438
80 3300056856 Ga0562375_0007 Ga0562375_0007_735902_737218 438
81 iso_pr_bacteria 2703719239 2706052477 438
82 iso_pr_bacteria 2703719240 2706057238 438
83 iso_pr_bacteria 2718217944 2719461338 438
84 iso_pr_bacteria 2870361953 2870362144 438
85 iso_pr_bacteria 2874434233 2874437028 438
86 iso_pr_bacteria 2874504452 2874505149 438
87 iso_pr_bacteria 2878947168 2878950969 438
88 iso_pr_bacteria 2885043073 2885043572 438
89 iso_pr_bacteria 2885046828 2885046903 438
90 iso_pr_bacteria 2885050628 2885051954 438
91 iso_pr_bacteria 2885054481 2885055001 438
92 iso_pr_bacteria 2885058212 2885061785 438
93 iso_pr_bacteria 2885061987 2885062491 438
94 iso_pr_bacteria 2885065815 2885066370 438
95 iso_pr_bacteria 2922113941 2922118278 438
96 iso_pr_bacteria 2937735258 2937737058 438
97 iso_pr_bacteria 2937751072 2937755426 438
98 iso_pr_bacteria 2961206375 2961207299 438
99 iso_pr_bacteria 2961232173 2961236067 438
100 iso_pr_bacteria 2961247850 2961251728 438
101 iso_pr_bacteria 2965197371 2965199609 438
102 iso_pr_bacteria 2970791725 2970791855 438
103 iso_pr_bacteria 2978161719 2978164303 438
104 iso_pr_bacteria 2996406003 2996407307 438
105 iso_pr_bacteria 2996467878 2996472910 438
106 iso_pr_bacteria 3007994558 3007999120 438
107 iso_pr_bacteria 637000270 637852581 438
108 iso_pr_bacteria 651285005 651303510 438
109 iso_pr_bacteria 8004285568 8004290017 438
110 iso_pr_bacteria 8004307473 8004311452 438
111 iso_pr_bacteria 8004541719 8004544502 438
112 iso_pr_bacteria 8004571736 8004572730 438
113 iso_pr_bacteria 8004582426 8004587431 438
114 2035918003 DPOL_contig00174 DPOLB_823550 439
115 2035918003 DPOL_contig13333 DPOLB_674510 439
116 2065487013 FGTW_contig30482 FGTW_00907200 439
117 2225789004 2227080800 2227454448 439
118 3300002464 Meta3P_1001785 Meta3P_10017852 439
119 3300024582 Ga0265387_1000023 Ga0265387_100002320 439
120 3300024582 Ga0265387_1000155 Ga0265387_10001552 439
121 3300042602 Ga0466713_040227 Ga0466713_040227_7239_8558 439
122 3300042602 Ga0466713_140209 Ga0466713_140209_4398_5717 439
123 3300042602 Ga0466713_150007 Ga0466713_150007_57157_58476 439
124 3300042625 Ga0466730_002459 Ga0466730_002459_9559_10878 439
125 3300042625 Ga0466730_002517 Ga0466730_002517_1746_3065 439
126 3300042625 Ga0466730_009810 Ga0466730_009810_13834_15153 439
127 3300042625 Ga0466730_052249 Ga0466730_052249_27_1346 439
128 3300042625 Ga0466730_100474 Ga0466730_100474_2366_3685 439
129 3300042649 Ga0466724_29726 Ga0466724_29726_62073_63392 439
130 3300042649 Ga0466724_38169 Ga0466724_38169_36027_37346 439
131 3300056842 Ga0562377_0016 Ga0562377_0016_1182635_1183954 439
132 iso_pr_bacteria 2507262057 2507518158 439
133 iso_pr_bacteria 2513020017 2513101565 439
134 iso_pr_bacteria 2519899623 2520393533 439
135 iso_pr_bacteria 2531839602 2534154414 439
136 iso_pr_bacteria 2537561600 2537924980 439
137 iso_pr_bacteria 2547132185 2547710391 439
138 iso_pr_bacteria 2548876931 2550377832 439
139 iso_pr_bacteria 2551306516 2553377766 439
140 iso_pr_bacteria 2551306531 2553450269 439
141 iso_pr_bacteria 2574179716 2574242819 439
142 iso_pr_bacteria 2588253732 2588527972 439
143 iso_pr_bacteria 2588253791 2588728809 439
144 iso_pr_bacteria 2619619082 2620612607 439
145 iso_pr_bacteria 2645727860 2647287998 439
146 iso_pr_bacteria 2645727860 2647287999 439
147 iso_pr_bacteria 2648501209 2648983724 439
148 iso_pr_bacteria 2648501209 2648983725 439
149 iso_pr_bacteria 2651870110 2653797049 439
150 iso_pr_bacteria 2756170277 2756798795 439
151 iso_pr_bacteria 2765235945 2766082296 439
152 iso_pr_bacteria 2778261152 2779036845 439
153 iso_pr_bacteria 2778261153 2779041138 439
154 iso_pr_bacteria 2824588292 2824590976 439
155 iso_pr_bacteria 2835335304 2835339925 439
156 iso_pr_bacteria 2836714267 2836717345 439
157 iso_pr_bacteria 2837516909 2837517770 439
158 iso_pr_bacteria 2846386538 2846387650 439
159 iso_pr_bacteria 2847708326 2847709150 439
160 iso_pr_bacteria 2856068565 2856070630 439
161 iso_pr_bacteria 2859315706 2859321213 439
162 iso_pr_bacteria 2871760914 2871763319 439
163 iso_pr_bacteria 2871771314 2871772875 439
164 iso_pr_bacteria 2874880541 2874882713 439
165 iso_pr_bacteria 2876334352 2876334729 439
166 iso_pr_bacteria 2876358570 2876361155 439
167 iso_pr_bacteria 2921816052 2921817980 439
168 iso_pr_bacteria 2921842437 2921845001 439
169 iso_pr_bacteria 2937387794 2937391922 439
170 iso_pr_bacteria 2937427229 2937431071 439
171 iso_pr_bacteria 2938192669 2938196359 439
172 iso_pr_bacteria 2957730672 2957734814 439
173 iso_pr_bacteria 2964846109 2964847797 439
174 iso_pr_bacteria 2964859436 2964863099 439
175 iso_pr_bacteria 2967915117 2967918087 439
176 iso_pr_bacteria 2967924226 2967925519 439
177 iso_pr_bacteria 2970322301 2970323363 439
178 iso_pr_bacteria 2970335472 2970337911 439
179 iso_pr_bacteria 2971189173 2971190707 439
180 iso_pr_bacteria 2977691992 2977695320 439
181 iso_pr_bacteria 2977727922 2977732169 439
182 iso_pr_bacteria 2977745872 2977748316 439
183 iso_pr_bacteria 2978102237 2978105931 439
184 iso_pr_bacteria 2979682021 2979685559 439
185 iso_pr_bacteria 2986970932 2986971572 439
186 iso_pr_bacteria 3001459110 3001459227 439
187 iso_pr_bacteria 3001462594 3001463449 439
188 iso_pr_bacteria 3004010258 3004013101 439
189 iso_pr_bacteria 3004364956 3004366259 439
190 iso_pr_bacteria 644736334 644772223 439
191 iso_pr_bacteria 648276708 648767482 439
192 iso_pr_bacteria 651324086 651696020 439
193 iso_pr_bacteria 8004118532 8004120488 439
194 iso_pr_bacteria 8006199443 8006200137 439
195 iso_pr_bacteria 8018312681 8018315143 439
196 iso_pr_bacteria 8021535516 8021535611 439
197 iso_pr_bacteria 8021540981 8021545199 439
198 iso_pr_bacteria 8028002147 8028002851 439
199 iso_pr_bacteria 8062647588 8062650200 439
200 iso_pr_bacteria 8065462725 8065463642 439
201 iso_pr_bacteria 8065466226 8065466252 439
202 iso_pr_bacteria 8065469765 8065470676 439
203 iso_pr_bacteria 8071322446 8071323204 439
204 iso_pr_bacteria 8071333649 8071335055 439
205 iso_pr_bacteria 8071338694 8071339470 439
206 iso_pr_bacteria 8071343737 8071346891 439
207 iso_pr_bacteria 8073124432 8073125239 439
208 iso_pr_bacteria 8074288691 8074289582 439
209 iso_pr_bacteria 8074292191 8074294952 439
210 iso_pr_bacteria 8100171289 8100173089 439
211 iso_pr_bacteria 8100176769 8100179210 439
212 iso_pr_bacteria 8100181737 8100184186 439
213 iso_pr_bacteria 8102982778 8102987320 439
214 3300002732 WW0001_100081 WW0001_100081121 440
215 3300003973 Ga0063521_1000916 Ga0063521_10009164 440
216 3300003973 Ga0063521_1001972 Ga0063521_10019721 440
217 3300007106 Ga0104041_1001774 Ga0104041_10017746 440
218 3300007149 Ga0104040_1041306 Ga0104040_10413064 440
219 3300007505 Ga0105005_1090718 Ga0105005_10907185 440
220 3300007767 Ga0105553_1034195 Ga0105553_10341959 440
221 3300009453 Ga0127656_100815 Ga0127656_10081514 440
222 3300010217 Ga0136159_1000066 Ga0136159_10000667 440
223 3300012837 Ga0160455_102232 Ga0160455_1022322 440
224 3300012839 Ga0160472_100022 Ga0160472_100022116 440
225 3300042649 Ga0466724_60250 Ga0466724_60250_2770_4092 440
226 iso_pr_bacteria 2510065004 2510076027 440
227 iso_pr_bacteria 2703719239 2706052991 440
228 iso_pr_bacteria 2703719240 2706058315 440
229 iso_pr_bacteria 2718217944 2719464762 440
230 iso_pr_bacteria 2833053935 2833055902 440
231 iso_pr_bacteria 2874434233 2874438421 440
232 iso_pr_bacteria 2874504452 2874508081 440
233 iso_pr_bacteria 2878947168 2878949919 440
234 iso_pr_bacteria 2898975184 2898976132 440
235 iso_pr_bacteria 2898991528 2898994710 440
236 iso_pr_bacteria 2901296437 2901298465 440
237 iso_pr_bacteria 2922113941 2922115952 440
238 iso_pr_bacteria 2937735258 2937737537 440
239 iso_pr_bacteria 2937751072 2937755744 440
240 iso_pr_bacteria 2961206375 2961207025 440
241 iso_pr_bacteria 2961232173 2961233225 440
242 iso_pr_bacteria 2961247850 2961252929 440
243 iso_pr_bacteria 2965197371 2965198084 440
244 iso_pr_bacteria 2970791725 2970792628 440
245 iso_pr_bacteria 2978161719 2978165931 440
246 iso_pr_bacteria 2996406003 2996407162 440
247 iso_pr_bacteria 2996467878 2996468170 440
248 iso_pr_bacteria 8001394582 8001395644 440
249 iso_pr_bacteria 8004285568 8004287908 440
250 iso_pr_bacteria 8004307473 8004308163 440
251 iso_pr_bacteria 8004541719 8004545993 440
252 iso_pr_bacteria 8004571736 8004575736 440
253 iso_pr_bacteria 8004582426 8004587502 440
254 iso_pr_bacteria 8099192374 8099195863 440
255 iso_pr_bacteria 8103002986 8103007850 440
256 iso_pr_bacteria 8103008710 8103013070 440
257 3300002464 Meta3P_1000412 Meta3P_100041222 441
258 3300003973 Ga0063521_1000013 Ga0063521_100001359 441
259 3300003973 Ga0063521_1000020 Ga0063521_100002082 441
260 3300042649 Ga0466724_07498 Ga0466724_07498_2471_3796 441
261 iso_pr_bacteria 2507262057 2507516350 441
262 iso_pr_bacteria 2529292851 2530235879 441
263 iso_pr_bacteria 2597489902 2597920245 441
264 iso_pr_bacteria 2597489903 2597926468 441
265 iso_pr_bacteria 2850131454 2850135056 441
266 iso_pr_bacteria 2896187957 2896189989 441
267 iso_pr_bacteria 3000478755 3000481258 441
268 3300002464 Meta3P_1000754 Meta3P_100075412 442
269 3300003973 Ga0063521_1000034 Ga0063521_100003434 442
270 3300042625 Ga0466730_069675 Ga0466730_069675_3040_4368 442
271 iso_pr_bacteria 8101676404 8101678356 442
272 iso_pr_bacteria 8101680043 8101682080 442
273 iso_pr_bacteria 8101683685 8101686082 442
274 iso_pr_bacteria 2518285522 2518342368 443
275 3300003973 Ga0063521_1000060 Ga0063521_10000602 444
276 3300007153 Ga0104050_1026993 Ga0104050_10269932 444
277 3300012828 Ga0160431_100097 Ga0160431_10009770 444
278 3300042598 Ga0466701_007859 Ga0466701_007859_83119_84453 444
279 iso_pr_bacteria 8076030444 8076031063 444
280 iso_pr_bacteria 8030337018 8030338064 445
281 3300012854 Ga0160448_103304 Ga0160448_1033043 447
282 iso_pr_bacteria 2811995301 2813755466 447
283 iso_pr_bacteria 2997944163 2997945592 447
284 iso_pr_bacteria 2881375749 2881377452 450
285 iso_pr_bacteria 2590828839 2593252724 452
286 iso_pr_bacteria 2593339124 2595063304 452
287 iso_pr_bacteria 8076029003 8076029550 456
288 2225789004 2227535715 2228051575 457
289 3300007505 Ga0105005_1009735 Ga0105005_10097351 458
290 iso_pr_bacteria 3000861951 3000863249 458
291 3300042602 Ga0466713_085938 Ga0466713_085938_963_2351 462
292 iso_pr_bacteria 648861007 648921745 463
293 iso_pr_bacteria 8011357093 8011358295 463
294 iso_pr_bacteria 2503904012 2503957841 464
295 3300042601 Ga0466707_309270 Ga0466707_309270_2386_3786 466
296 iso_pr_bacteria 8021546568 8021549445 467
297 3300002932 CVPL010L_1000556 CVPL010L_10005562 468
298 3300056790 Ga0562379_0710 Ga0562379_0710_52267_53694 475
299 3300056857 Ga0562376_2458 Ga0562376_2458_15294_16721 475
300 2100351016 SWWA_contig01906__length_2996___numreads_58 SWWA_02857180 478

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05525 Branch_AA_trans Branched-chain amino acid transport protein 47 468 0.99

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6csf-assembly2.cif.gz_M Crystal structure of sodium/alanine symporter AgcS with D-alanine bound 0.687 31 401
8e6n-assembly1.cif.gz_A X-ray structure of the Deinococcus radiodurans Nramp/MntH divalent transition metal transporter G223W mutant in an outward-open, manganese-bound state 0.66 49 428
7qoa-assembly2.cif.gz_B Structure of CodB, a cytosine transporter in an outward-facing conformation 0.652 50 465
8e6m-assembly1.cif.gz_A X-ray structure of the Deinococcus radiodurans Nramp/MntH divalent transition metal transporter WT in an inward-open, cadmium-bound state 0.649 51 427
3p03-assembly1.cif.gz_C Crystal structure of BetP-G153D with choline bound 0.645 51 428
IDDescriptionScoreStartEndSuperfamily
af_P0AD99_6_430_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.996 46 469 1.20.1740.10
af_Q2G171_2_420_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9457 58 470 1.20.1740.10
af_Q2FYM4_4_445_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9431 53 469 1.20.1740.10
af_Q2G1H2_6_444_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9378 46 469 1.20.1740.10
af_Q2G0E6_5_354_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7372 49 402 1.20.1740.10
IDDescriptionScoreStartEndGO Terms
AF-A0A328XRA7-F1-model_v4 Branched-chain amino acid transport system carrier protein 0.9676 41 470 GO:0005886
GO:0015188
GO:0015190
GO:0005304
GO:0015818
GO:0015820
AF-A0A378ATM5-F1-model_v4 Branched-chain amino acid transport system carrier protein 0.9658 73 309 GO:0005886
GO:0015188
GO:0015190
GO:0005304
GO:0015818
GO:0015820

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.