Protein Family IF00066

Metagenome Isolate
351 Members
70 Samples
110 Scaffolds
587.22 Avg Length

🧬 Representative Sequence

ID
2100351016|SWWA_contig00794__length_6125___numreads_127|SWWA_02457400
Length
645 aa
Sequence
MRRLLFLAGVRMAAKLELLIAQTILQGFDAQYGRFLEVTAGAQQRFEQADWPAVQQAMKKRIHLYDHHVGLVVEQLKCITGQKYFDADFPSRVKAVYIDLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVFSSQPERRFRDIPRPLARDFTPNGDLPAMLRSVLSDLPLRLPWEDLARDIRDITQALQRAFSAAQLAGATFQIANELFYRNKAAWLVGKLRLADGVYPFLLPIHHSESGALFIDACLTGKAEASIVFGFARSYFMVYAPLPAAMVEWLREILPGKTTAELYMAIGCQKHGKTECYREYLTFMAQSQEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKDEFAPQKEVTQAQVMACYQLVKEHDRVGRMADTQEYENFVVDKARLSTELLAELRREVPGKLEDLGDRIVIKHLYMERRMTPLNLYLEQANDQQMRDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELASEPWYSIAPNDVFPEEFRHFLCGDRRIRRVFEELHSDLFTAEYWRGLQQRIREGTWKTCSLTARSSGSASAAGRRCRPPPLRCKSGLGARDGGARQFGDAGVVAAFQRVRRHQPGAADAQHAFQRQIAAVIVR

📊 Sample Types

Isolate 68.7%
Metagenome 31.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🦗 Order Distribution

Amphipoda 0.8%
Anostraca 0.0%
Araneae 0.0%
Blattodea 0.3%
Calanoida 0.0%
Coleoptera 13.7%
Copepoda 0.0%
Decapoda 0.8%
Diplopoda 2.3%
Diplostraca 0.3%
Diptera 17.1%
Euphausiacea 0.0%
Hemiptera 32.2%
Hymenoptera 6.3%
Insect (unknown) 0.0%
Isopoda 2.0%
Isoptera 13.4%
Ixodida 0.0%
Lepidoptera 1.1%
Mecoptera 0.0%
NA 0.0%
Odonata 0.0%
Orthoptera 0.0%
Phthiraptera 0.0%
Psocodea 0.0%
Sarcoptiformes 0.0%
Siphonaptera 0.3%
Spirobolida 0.0%
Thysanoptera 0.3%
Trombidiformes 0.0%

🌳 Taxonomy

Archaea 0
Bacteria 325
Eukaryota 0
Viruses 0
Unclassified 26

🗂️ Samples

#Sample IDDescriptionTypeEnvironment
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Diplopoda
2 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Diplopoda
3 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Hymenoptera
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome Isoptera
5 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Hymenoptera
6 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Diptera
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Isoptera
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Isoptera
9 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Coleoptera
10 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Hymenoptera
11 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Isoptera
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Isoptera
13 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome Diplopoda
14 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Isopoda
15 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Lepidoptera
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Isoptera
17 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome Isoptera
18 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Hymenoptera
19 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Diptera
20 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Hymenoptera
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Isoptera
22 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome Diplopoda
23 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Diptera
24 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome Isoptera
25 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Lepidoptera
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Isoptera
27 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Isoptera
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Isoptera
29 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Diptera
30 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Hymenoptera
31 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Isopoda
32 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Diptera
33 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Hymenoptera
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Isoptera
35 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Coleoptera
36 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Hymenoptera
37 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Hymenoptera
38 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Hymenoptera
39 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Diptera
40 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Isoptera
41 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Coleoptera
42 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Coleoptera
43 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Coleoptera
44 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Diptera
45 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Hymenoptera
46 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome Diplopoda
47 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Isopoda
48 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Diptera
49 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Isoptera
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Isoptera
51 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Coleoptera
52 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Coleoptera
53 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Diptera
54 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Hymenoptera
55 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Diptera
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Isoptera
57 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Diptera
58 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Isopoda
59 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Isoptera
60 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Isoptera
61 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Hymenoptera
62 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Hymenoptera
63 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome Diplopoda
64 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Diptera
65 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome Diplopoda
66 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Isopoda
67 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Diptera
68 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Isoptera
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Isoptera
70 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Isoptera

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 SWWA_contig00794__length_6125___numreads_127 2100351016 Bacteria 6125
2 Meta3P_1000666 3300002464 Bacteria 14190
3 Meta3P_1008536 3300002464 Unclassified 13447
4 CVPL010L_1000067 3300002932 Bacteria 46570
5 Ga0063521_1000264 3300003973 Bacteria 34547
6 Ga0104041_1001652 3300007106 Unclassified 10331
7 Ga0103268_1001066 3300007192 Unclassified 7754
8 Ga0160466_100127 3300012809 Unclassified 64497
9 Ga0160443_100170 3300012848 Bacteria 88911
10 Ga0265387_1000009 3300024582 Bacteria 83689
11 Ga0466730_005650 3300042625 Bacteria 17786
12 Ga0466724_09210 3300042649 Unclassified 13277
13 Ga0466701_075792 3300042598 Bacteria 32408
14 Ga0562378_0299 3300056814 Bacteria 103228
15 DPO_contig00368 2032320009 Bacteria 33940
16 SPBB_contig00683 2044078006 Bacteria 163833
17 SPBB_contig11507 2044078006 Bacteria 117601
18 Ga0074188_1155265 3300005318 Unclassified 2745
19 Ga0102734_1002296 3300007129 Bacteria 4525
20 Ga0103264_1004624 3300007188 Bacteria 6479
21 Ga0123357_10152984 3300009784 Unclassified 2792
22 Ga0123354_10000044 3300010882 Bacteria 93974
23 Ga0160465_100391 3300012803 Unclassified 23601
24 Ga0160464_100061 3300012805 Unclassified 130455
25 Ga0160467_100961 3300012829 Unclassified 16384
26 Ga0160447_109344 3300012849 Unclassified 2258
27 Ga0160448_100031 3300012854 Bacteria 141009
28 Ga0265387_1000294 3300024582 Bacteria 8418
29 Ga0247290_00098 3300035364 Bacteria 27424
30 Ga0466701_007049 3300042598 Bacteria 22470
31 Ga0466730_035466 3300042625 Bacteria 27809
32 Ga0466730_035978 3300042625 Bacteria 6470
33 Ga0466724_45528 3300042649 Bacteria 53048
34 Ga0466701_045525 3300042598 Bacteria 19769
35 Ga0466713_060579 3300042602 Bacteria 62557
36 Ga0562374_0001 3300057007 Bacteria 4762007
37 FGTW_contig31381 2065487013 Unclassified 4654
38 Ga0063521_1000736 3300003973 Bacteria 12144
39 Ga0072941_1572981 3300005201 Bacteria 2453
40 Ga0105553_1034172 3300007767 Bacteria 10379
41 Ga0160470_100216 3300012813 Bacteria 46291
42 Ga0466730_004904 3300042625 Bacteria 17999
43 Ga0466724_19558 3300042649 Bacteria 94374
44 Ga0466733_103649 3300042659 Bacteria 4127
45 Ga0562375_1509 3300056856 Bacteria 30851
46 Ga0103265_1000767 3300007068 Bacteria 5331
47 Ga0102735_1001139 3300007080 Bacteria 5341
48 Ga0160472_100375 3300012839 Unclassified 38306
49 Ga0466657_212213 3300042582 Bacteria 50857
50 Ga0466692_052496 3300042591 Bacteria 9743
51 Ga0466693_234165 3300042592 Bacteria 4429
52 Ga0466725_270457 3300042654 Bacteria 24948
53 Ga0466713_063427 3300042602 Bacteria 192176
54 DPOL_contig14916 2035918003 Bacteria 26157
55 FGTW_contig30521 2065487013 Bacteria 19487
56 IMNBGM34_c000780 3300000036 Bacteria 7452
57 CVPL010W_10026823 3300002931 Unclassified 2620
58 Ga0063521_1000349 3300003973 Bacteria 26705
59 Ga0160440_100369 3300012815 Bacteria 18603
60 Ga0160433_100684 3300012846 Bacteria 13166
61 Ga0247290_00518 3300035364 Unclassified 6847
62 Ga0466695_049312 3300042595 Bacteria 6467
63 Ga0466710_075559 3300042613 Bacteria 7252
64 Ga0466730_042171 3300042625 Unclassified 17569
65 Ga0466724_02107 3300042649 Bacteria 7369
66 Ga0466701_081657 3300042598 Bacteria 94039
67 DPO_contig06476 2032320009 Bacteria 20432
68 DPOL_contig17071 2035918003 Unclassified 9946
69 Ga0074188_1000763 3300005318 Bacteria 10212
70 Ga0103261_1002963 3300007083 Bacteria 2650
71 Ga0160471_100072 3300012812 Unclassified 89657
72 Ga0160431_100328 3300012828 Bacteria 26267
73 Ga0160447_100156 3300012849 Bacteria 45211
74 Ga0160435_1008037 3300012857 Unclassified 2282
75 Ga0247289_0053 3300035363 Bacteria 36283
76 Ga0466724_07617 3300042649 Bacteria 46668
77 2227480188 2225789004 Bacteria 77366
78 CVPL005W_1000353 3300002934 Bacteria 19720
79 Ga0063521_1000731 3300003973 Unclassified 12280
80 Ga0103265_1000937 3300007068 Bacteria 4824
81 Ga0103264_1001274 3300007188 Unclassified 11100
82 Ga0105005_1039051 3300007505 Bacteria 13538
83 Ga0123355_10132557 3300009826 Bacteria 3835
84 Ga0123356_10046457 3300010049 Bacteria 4039
85 Ga0160446_102082 3300012835 Bacteria 3711
86 Ga0160447_101779 3300012849 Bacteria 8066
87 Ga0316159_10849 3300030930 Bacteria 4319
88 Ga0466710_055253 3300042613 Bacteria 6790
89 Ga0466715_143205 3300042616 Bacteria 113538
90 Ga0466734_021821 3300042623 Bacteria 5742
91 Ga0466730_001800 3300042625 Bacteria 17667
92 Ga0466724_16727 3300042649 Unclassified 117548
93 Ga0466724_63383 3300042649 Bacteria 3324
94 Ga0466701_068458 3300042598 Bacteria 165759
95 Ga0466706_215617 3300042599 Bacteria 2464
96 Ga0103266_1000052 3300007067 Bacteria 50041
97 Ga0104051_1019343 3300007078 Unclassified 4465
98 Ga0102739_1000678 3300007095 Bacteria 6417
99 Ga0103267_1000043 3300007190 Bacteria 94946
100 Ga0123356_10006330 3300010049 Bacteria 11952
101 Ga0160469_100371 3300012824 Bacteria 24204
102 Ga0160455_100190 3300012837 Bacteria 58190
103 Ga0160472_100719 3300012839 Bacteria 15346
104 Ga0160433_100434 3300012846 Bacteria 21669
105 Ga0160443_100920 3300012848 Unclassified 13665
106 Ga0466730_009828 3300042625 Unclassified 4939
107 Ga0466724_11030 3300042649 Bacteria 52366
108 Ga0466724_25632 3300042649 Bacteria 18768
109 Ga0466701_022040 3300042598 Bacteria 46095
110 Ga0466707_354220 3300042601 Unclassified 7792

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10046457 Ga0123356_100464573 556
2 3300056856 Ga0562375_1509 Ga0562375_1509_5034_6782 565
3 3300010049 Ga0123356_10006330 Ga0123356_100063305 566
4 3300042613 Ga0466710_055253 Ga0466710_055253_3989_5695 568
5 2044078006 SPBB_contig11507 SPBB_276420 569
6 3300009826 Ga0123355_10132557 Ga0123355_101325573 569
7 3300042649 Ga0466724_45528 Ga0466724_45528_12242_13951 569
8 2065487013 FGTW_contig30521 FGTW_01216740 570
9 3300002931 CVPL010W_10026823 CVPL010W_100268232 570
10 3300002934 CVPL005W_1000353 CVPL005W_10003532 570
11 3300012803 Ga0160465_100391 Ga0160465_10039121 570
12 3300012815 Ga0160440_100369 Ga0160440_10036910 570
13 3300012828 Ga0160431_100328 Ga0160431_10032826 570
14 iso_pr_bacteria 2837516909 2837519838 570
15 iso_pr_bacteria 2846386538 2846390619 570
16 2032320009 DPO_contig00368 DPOB_433570 571
17 2032320009 DPO_contig06476 DPOB_472370 571
18 3300003973 Ga0063521_1000731 Ga0063521_10007315 571
19 3300003973 Ga0063521_1000736 Ga0063521_10007364 571
20 3300007067 Ga0103266_1000052 Ga0103266_100005244 571
21 3300042598 Ga0466701_081657 Ga0466701_081657_34808_36523 571
22 3300042616 Ga0466715_143205 Ga0466715_143205_85698_87413 571
23 3300042649 Ga0466724_11030 Ga0466724_11030_21162_22877 571
24 3300042649 Ga0466724_19558 Ga0466724_19558_57376_59091 571
25 iso_pr_bacteria 2864745180 2864745651 571
26 iso_pr_bacteria 2864853652 2864853941 571
27 iso_pr_bacteria 3007478678 3007479511 571
28 iso_pr_bacteria 637000219 638002914 571
29 iso_pr_bacteria 8011329375 8011330088 571
30 iso_pr_bacteria 8035422605 8035426563 571
31 iso_pr_bacteria 8052469819 8052473441 571
32 2044078006 SPBB_contig00683 SPBB_423150 572
33 3300012849 Ga0160447_101779 Ga0160447_1017797 572
34 iso_pr_bacteria 2687453754 2690042177 572
35 iso_pr_bacteria 2687453755 2690044709 572
36 iso_pr_bacteria 2687453756 2690045660 572
37 iso_pr_bacteria 2756170277 2756799694 572
38 iso_pr_bacteria 2864739902 2864740470 572
39 2035918003 DPOL_contig14916 DPOLB_324130 573
40 3300007068 Ga0103265_1000767 Ga0103265_10007673 573
41 3300007083 Ga0103261_1002963 Ga0103261_10029632 573
42 3300007095 Ga0102739_1000678 Ga0102739_10006781 573
43 3300007188 Ga0103264_1001274 Ga0103264_10012742 573
44 3300007192 Ga0103268_1001066 Ga0103268_10010663 573
45 3300012809 Ga0160466_100127 Ga0160466_10012737 573
46 3300012813 Ga0160470_100216 Ga0160470_10021638 573
47 3300012829 Ga0160467_100961 Ga0160467_1009614 573
48 3300012839 Ga0160472_100375 Ga0160472_10037518 573
49 iso_pr_bacteria 2519899622 2520391525 573
50 iso_pr_bacteria 2835335304 2835335807 573
51 iso_pr_bacteria 8035326735 8035328010 573
52 3300002464 Meta3P_1008536 Meta3P_100853610 574
53 3300005318 Ga0074188_1000763 Ga0074188_10007633 574
54 3300012824 Ga0160469_100371 Ga0160469_1003719 574
55 3300012846 Ga0160433_100434 Ga0160433_10043420 574
56 3300012848 Ga0160443_100920 Ga0160443_10092010 574
57 3300042625 Ga0466730_009828 Ga0466730_009828_1462_3186 574
58 iso_pr_bacteria 2510065002 2510070254 574
59 iso_pr_bacteria 2510065003 2510073827 574
60 iso_pr_bacteria 2524614872 2526113130 574
61 iso_pr_bacteria 2836755666 2836759928 574
62 2225789004 2227480188 2227939248 575
63 iso_pr_bacteria 2864764899 2864766299 575
64 iso_pr_bacteria 2864768727 2864769340 575
65 iso_pr_bacteria 2864777284 2864778568 575
66 iso_pr_bacteria 2864791955 2864792528 575
67 iso_pr_bacteria 2864796242 2864796721 575
68 iso_pr_bacteria 2889908211 2889912120 575
69 iso_pr_bacteria 2938192669 2938197652 575
70 3300012846 Ga0160433_100684 Ga0160433_1006845 576
71 3300042625 Ga0466730_004904 Ga0466730_004904_13516_15246 576
72 iso_pr_bacteria 2529292851 2530236273 576
73 iso_pr_bacteria 2597489903 2597926672 576
74 iso_pr_bacteria 2864847319 2864849899 576
75 3300007080 Ga0102735_1001139 Ga0102735_10011393 577
76 3300007188 Ga0103264_1004624 Ga0103264_10046242 577
77 3300007190 Ga0103267_1000043 Ga0103267_10000433 577
78 3300042601 Ga0466707_354220 Ga0466707_354220_5386_7119 577
79 3300042625 Ga0466730_035466 Ga0466730_035466_6265_7998 577
80 3300042649 Ga0466724_07617 Ga0466724_07617_39997_41730 577
81 iso_pr_bacteria 2588253791 2588727920 577
82 iso_pr_bacteria 2597489902 2597919963 577
83 iso_pr_bacteria 2824588292 2824588834 577
84 iso_pr_bacteria 2850131454 2850131458 577
85 iso_pr_bacteria 2864903489 2864904693 577
86 iso_pr_bacteria 2864944480 2864945791 577
87 iso_pr_bacteria 2885043073 2885046181 577
88 iso_pr_bacteria 2885046828 2885049931 577
89 iso_pr_bacteria 2885050628 2885053796 577
90 iso_pr_bacteria 2885054481 2885057388 577
91 iso_pr_bacteria 2885058212 2885061318 577
92 iso_pr_bacteria 2885061987 2885064979 577
93 iso_pr_bacteria 2885065815 2885068793 577
94 iso_pr_bacteria 2898991528 2898992029 577
95 iso_pr_bacteria 8011357093 8011360468 577
96 iso_pr_bacteria 8102982778 8102987449 577
97 3300005318 Ga0074188_1155265 Ga0074188_11552652 578
98 3300007078 Ga0104051_1019343 Ga0104051_10193433 578
99 3300007106 Ga0104041_1001652 Ga0104041_10016523 578
100 3300007505 Ga0105005_1039051 Ga0105005_10390516 578
101 3300012849 Ga0160447_100156 Ga0160447_10015611 578
102 3300012857 Ga0160435_1008037 Ga0160435_10080372 578
103 3300030930 Ga0316159_10849 Ga0316159_108492 578
104 3300042591 Ga0466692_052496 Ga0466692_052496_3291_5027 578
105 3300042599 Ga0466706_215617 Ga0466706_215617_711_2447 578
106 3300042625 Ga0466730_042171 Ga0466730_042171_4465_6201 578
107 3300042649 Ga0466724_16727 Ga0466724_16727_111250_112986 578
108 iso_pr_bacteria 2778261152 2779040742 578
109 iso_pr_bacteria 2778261153 2779043821 578
110 iso_pr_bacteria 2864926767 2864931231 578
111 iso_pr_bacteria 2871771314 2871772525 578
112 iso_pr_bacteria 8071322446 8071326129 578
113 iso_pr_bacteria 8071333649 8071337635 578
114 iso_pr_bacteria 8071338694 8071342331 578
115 iso_pr_bacteria 8071343737 8071347871 578
116 iso_pr_bacteria 8073124432 8073124978 578
117 3300035364 Ga0247290_00098 Ga0247290_00098_4372_6111 579
118 3300042602 Ga0466713_060579 Ga0466713_060579_56094_57833 579
119 3300057007 Ga0562374_0001 Ga0562374_0001_2440759_2442498 579
120 iso_pr_bacteria 2896187957 2896189267 579
121 iso_pr_bacteria 3007994558 3007998027 579
122 3300003973 Ga0063521_1000264 Ga0063521_100026426 580
123 3300042625 Ga0466730_035978 Ga0466730_035978_4371_6113 580
124 3300042649 Ga0466724_02107 Ga0466724_02107_677_2419 580
125 3300042649 Ga0466724_09210 Ga0466724_09210_4739_6481 580
126 iso_pr_bacteria 2519899623 2520394233 580
127 iso_pr_bacteria 2833053935 2833056642 580
128 iso_pr_bacteria 2841260384 2841264156 580
129 iso_pr_bacteria 2987233858 2987237320 580
130 iso_pr_bacteria 8021535516 8021537822 580
131 iso_pr_bacteria 8028002147 8028002153 580
132 iso_pr_bacteria 8101676404 8101679888 580
133 iso_pr_bacteria 8101680043 8101683604 580
134 iso_pr_bacteria 8101683685 8101684398 580
135 3300003973 Ga0063521_1000349 Ga0063521_100034919 581
136 3300012848 Ga0160443_100170 Ga0160443_10017037 581
137 iso_pr_bacteria 2859315706 2859319463 581
138 iso_pr_bacteria 8103002986 8103004524 581
139 iso_pr_bacteria 8103008710 8103009396 581
140 3300007767 Ga0105553_1034172 Ga0105553_10341725 582
141 3300024582 Ga0265387_1000009 Ga0265387_10000096 582
142 3300024582 Ga0265387_1000294 Ga0265387_10002945 582
143 3300056814 Ga0562378_0299 Ga0562378_0299_94499_96247 582
144 iso_pr_bacteria 2619619082 2620611845 582
145 iso_pr_bacteria 2765235945 2766081586 582
146 iso_pr_bacteria 648276708 648770479 582
147 iso_pr_bacteria 8001059720 8001060689 582
148 iso_pr_bacteria 8062647588 8062647759 582
149 iso_pr_bacteria 8100171289 8100176449 582
150 iso_pr_bacteria 8100176769 8100176775 582
151 iso_pr_bacteria 8100181737 8100186512 582
152 iso_pr_bacteria 8110023836 8110024227 582
153 2065487013 FGTW_contig31381 FGTW_00078840 583
154 3300035364 Ga0247290_00518 Ga0247290_00518_661_2412 583
155 3300042598 Ga0466701_075792 Ga0466701_075792_24699_26450 583
156 3300042649 Ga0466724_25632 Ga0466724_25632_2214_3965 583
157 iso_pr_bacteria 2537561600 2537927945 583
158 iso_pr_bacteria 2547132185 2547709697 583
159 iso_pr_bacteria 2551306516 2553378459 583
160 iso_pr_bacteria 2551306531 2553450961 583
161 iso_pr_bacteria 2874880541 2874883431 583
162 2035918003 DPOL_contig17071 DPOLB_132560 584
163 3300002464 Meta3P_1000666 Meta3P_10006666 584
164 3300042598 Ga0466701_007049 Ga0466701_007049_20186_21940 584
165 3300042598 Ga0466701_045525 Ga0466701_045525_14009_15763 584
166 3300042654 Ga0466725_270457 Ga0466725_270457_19595_21349 584
167 iso_pr_bacteria 2820077244 2820078533 584
168 iso_pr_bacteria 2820161938 2820162671 584
169 iso_pr_bacteria 2820164216 2820165981 584
170 iso_pr_bacteria 2847708326 2847713201 584
171 iso_pr_bacteria 2874434233 2874438638 584
172 iso_pr_bacteria 2878947168 2878947791 584
173 iso_pr_bacteria 2922113941 2922115423 584
174 iso_pr_bacteria 2958255616 2958257681 584
175 iso_pr_bacteria 8004541719 8004545850 584
176 iso_pr_bacteria 8099192374 8099196714 584
177 3300010882 Ga0123354_10000044 Ga0123354_1000004488 585
178 3300042582 Ga0466657_212213 Ga0466657_212213_33878_35635 585
179 3300042613 Ga0466710_075559 Ga0466710_075559_4395_6152 585
180 3300012837 Ga0160455_100190 Ga0160455_10019044 586
181 3300042625 Ga0466730_005650 Ga0466730_005650_4577_6337 586
182 iso_pr_bacteria 2822856742 2822857004 586
183 iso_pr_bacteria 2978102237 2978103844 586
184 iso_pr_bacteria 8006199443 8006202248 586
185 3300009784 Ga0123357_10152984 Ga0123357_101529841 587
186 3300035363 Ga0247289_0053 Ga0247289_0053_29925_31688 587
187 iso_pr_bacteria 8018312681 8018315475 587
188 3300012854 Ga0160448_100031 Ga0160448_100031114 588
189 iso_pr_bacteria 2501651205 2501713064 588
190 iso_pr_bacteria 2585427605 2585887252 588
191 iso_pr_bacteria 2585428048 2587691952 588
192 3300005201 Ga0072941_1572981 Ga0072941_15729812 589
193 iso_pr_bacteria 2574179716 2574243506 589
194 iso_pr_bacteria 2971189173 2971191825 589
195 3300007129 Ga0102734_1002296 Ga0102734_10022962 590
196 3300042602 Ga0466713_063427 Ga0466713_063427_5249_7021 590
197 3300042659 Ga0466733_103649 Ga0466733_103649_1187_2959 590
198 iso_pr_bacteria 2518285522 2518344666 590
199 iso_pr_bacteria 2645727860 2647289703 592
200 iso_pr_bacteria 2648501209 2648986324 592
201 iso_pr_bacteria 2820157249 2820157413 592
202 iso_pr_bacteria 2820157249 2820157748 592
203 3300042649 Ga0466724_63383 Ga0466724_63383_1205_2989 594
204 iso_pr_bacteria 2507262057 2507518953 594
205 iso_pr_bacteria 2513020017 2513102334 594
206 iso_pr_bacteria 2531839602 2534154754 594
207 iso_pr_bacteria 2588253732 2588527189 594
208 iso_pr_bacteria 2836714267 2836718125 594
209 iso_pr_bacteria 8004118532 8004118537 594
210 iso_pr_bacteria 8021540981 8021543556 594
211 iso_pr_bacteria 8021546568 8021547056 594
212 3300002932 CVPL010L_1000067 CVPL010L_10000675 595
213 iso_pr_bacteria 2703719239 2706053196 595
214 iso_pr_bacteria 2703719240 2706058520 595
215 iso_pr_bacteria 2718217944 2719465128 595
216 iso_pr_bacteria 2937735258 2937740170 595
217 iso_pr_bacteria 2937751072 2937752672 595
218 iso_pr_bacteria 2961206375 2961209976 595
219 iso_pr_bacteria 2961232173 2961232882 595
220 iso_pr_bacteria 2961247850 2961251457 595
221 iso_pr_bacteria 2965197371 2965202462 595
222 iso_pr_bacteria 2970791725 2970794969 595
223 iso_pr_bacteria 2978161719 2978165939 595
224 iso_pr_bacteria 2996406003 2996407379 595
225 iso_pr_bacteria 2996467878 2996469945 595
226 iso_pr_bacteria 8004285568 8004287245 595
227 iso_pr_bacteria 8004307473 8004308167 595
228 iso_pr_bacteria 8004571736 8004573143 595
229 iso_pr_bacteria 8004582426 8004585302 595
230 iso_pr_bacteria 2856068565 2856069369 596
231 iso_pr_bacteria 2876334352 2876334362 596
232 iso_pr_bacteria 2876358570 2876358807 596
233 iso_pr_bacteria 2921816052 2921816559 596
234 iso_pr_bacteria 2921842437 2921842720 596
235 iso_pr_bacteria 2937387794 2937388303 596
236 iso_pr_bacteria 2937427229 2937427960 596
237 iso_pr_bacteria 2957730672 2957733553 596
238 iso_pr_bacteria 2964846109 2964846728 596
239 iso_pr_bacteria 2964859436 2964861468 596
240 iso_pr_bacteria 2967915117 2967919624 596
241 iso_pr_bacteria 2967924226 2967928244 596
242 iso_pr_bacteria 2970322301 2970325886 596
243 iso_pr_bacteria 2977691992 2977693569 596
244 iso_pr_bacteria 2977727922 2977728305 596
245 iso_pr_bacteria 2977745872 2977747749 596
246 iso_pr_bacteria 2979682021 2979685705 596
247 iso_pr_bacteria 3004364956 3004365752 596
248 iso_pr_bacteria 8023747282 8023751318 597
249 iso_pr_bacteria 8023752828 8023756336 597
250 iso_pr_bacteria 8024014383 8024014472 597
251 iso_pr_bacteria 8024019580 8024022421 597
252 iso_pr_bacteria 8024025509 8024028176 597
253 iso_pr_bacteria 8024044713 8024044817 597
254 iso_pr_bacteria 8025666332 8025666450 597
255 iso_pr_bacteria 8025723035 8025723120 597
256 iso_pr_bacteria 8025735396 8025736058 597
257 iso_pr_bacteria 8069770227 8069774263 597
258 iso_pr_bacteria 8069775773 8069779281 597
259 iso_pr_bacteria 8102014801 8102014878 597
260 iso_pr_bacteria 8102020860 8102021268 597
261 iso_pr_bacteria 8102054868 8102054991 597
262 iso_pr_bacteria 8102081745 8102082020 597
263 iso_pr_bacteria 8102169119 8102169781 597
264 iso_pr_bacteria 8102181083 8102181168 597
265 iso_pr_bacteria 8102246966 8102247084 597
266 iso_pr_bacteria 8025701579 8025705795 598
267 iso_pr_bacteria 8025728939 8025729100 598
268 iso_pr_bacteria 8102174626 8102174787 598
269 iso_pr_bacteria 8102201977 8102206193 598
270 iso_pr_bacteria 8023724303 8023728215 599
271 iso_pr_bacteria 8023757577 8023761489 599
272 iso_pr_bacteria 8023764196 8023769430 599
273 iso_pr_bacteria 8024001094 8024001186 599
274 iso_pr_bacteria 8025747911 8025748021 599
275 iso_pr_bacteria 8025756023 8025756133 599
276 iso_pr_bacteria 8069755105 8069755215 599
277 iso_pr_bacteria 8102041249 8102041334 599
278 iso_pr_bacteria 8102060671 8102060851 599
279 iso_pr_bacteria 8102074813 8102074959 599
280 iso_pr_bacteria 8102087471 8102087626 599
281 iso_pr_bacteria 8102145433 8102149345 599
282 iso_pr_bacteria 8102152052 8102157286 599
283 iso_pr_bacteria 8102161003 8102164923 599
284 iso_pr_bacteria 2597489944 2598056235 600
285 iso_pr_bacteria 8024037630 8024037723 600
286 iso_pr_bacteria 8025650824 8025650930 600
287 iso_pr_bacteria 8025658853 8025659282 600
288 iso_pr_bacteria 8025671076 8025671155 600
289 iso_pr_bacteria 8025678175 8025678266 600
290 iso_pr_bacteria 8025685901 8025686326 600
291 iso_pr_bacteria 8025694439 8025694628 600
292 iso_pr_bacteria 8025708040 8025708199 600
293 iso_pr_bacteria 8025716094 8025716494 600
294 iso_pr_bacteria 8025740903 8025740981 600
295 iso_pr_bacteria 8069748016 8069748936 600
296 iso_pr_bacteria 8069763219 8069763297 600
297 iso_pr_bacteria 8078130113 8078130200 600
298 iso_pr_bacteria 8101951471 8101951591 600
299 iso_pr_bacteria 8101960468 8101960588 600
300 iso_pr_bacteria 8101967387 8101967507 600
301 iso_pr_bacteria 8101974301 8101974421 600
302 iso_pr_bacteria 8101981714 8101981897 600
303 iso_pr_bacteria 8101988189 8101988397 600
304 iso_pr_bacteria 8101994502 8101994900 600
305 iso_pr_bacteria 8102001125 8102001162 600
306 iso_pr_bacteria 8102007614 8102007727 600
307 iso_pr_bacteria 8102026984 8102027207 600
308 iso_pr_bacteria 8102033761 8102034100 600
309 iso_pr_bacteria 8102047609 8102047872 600
310 iso_pr_bacteria 8102067727 8102067931 600
311 iso_pr_bacteria 8102094248 8102094644 600
312 iso_pr_bacteria 8102102351 8102102466 600
313 iso_pr_bacteria 8102109360 8102109476 600
314 iso_pr_bacteria 8102117041 8102117146 600
315 iso_pr_bacteria 8102124461 8102124769 600
316 iso_pr_bacteria 8102131453 8102132437 600
317 iso_pr_bacteria 8102138357 8102138454 600
318 iso_pr_bacteria 8102186987 8102187387 600
319 iso_pr_bacteria 8102193924 8102194083 600
320 iso_pr_bacteria 8102208438 8102208544 600
321 iso_pr_bacteria 8102216467 8102216656 600
322 iso_pr_bacteria 8102223607 8102223686 600
323 iso_pr_bacteria 8102230706 8102231131 600
324 iso_pr_bacteria 8102239244 8102239335 600
325 iso_pr_bacteria 8102251710 8102252139 600
326 iso_pr_bacteria 8102264549 8102264760 600
327 iso_pr_bacteria 8102271933 8102272223 600
328 iso_pr_bacteria 8102279326 8102279430 600
329 iso_pr_bacteria 8102286609 8102286951 600
330 iso_pr_bacteria 8102312426 8102312546 600
331 3300012805 Ga0160464_100061 Ga0160464_10006178 601
332 3300012849 Ga0160447_109344 Ga0160447_1093442 601
333 iso_pr_bacteria 2871760914 2871764728 601
334 3300007068 Ga0103265_1000937 Ga0103265_10009375 603
335 3300012839 Ga0160472_100719 Ga0160472_1007192 603
336 iso_pr_bacteria 8024031916 8024032027 603
337 3300042598 Ga0466701_068458 Ga0466701_068458_97427_99244 605
338 3300042595 Ga0466695_049312 Ga0466695_049312_2596_4416 606
339 iso_pr_bacteria 2603880173 2606037740 607
340 3300012812 Ga0160471_100072 Ga0160471_10007254 608
341 3300012835 Ga0160446_102082 Ga0160446_1020822 608
342 iso_pr_bacteria 3003869270 3003869507 608
343 3300000036 IMNBGM34_c000780 IMNBGM34_0007801 610
344 iso_pr_bacteria 2864968865 2864973338 610
345 iso_pr_bacteria 3003878002 3003878206 610
346 3300042625 Ga0466730_001800 Ga0466730_001800_3466_5304 612
347 iso_pr_bacteria 2970335472 2970337628 612
348 3300042598 Ga0466701_022040 Ga0466701_022040_44054_45901 615
349 3300042592 Ga0466693_234165 Ga0466693_234165_1200_3071 623
350 3300042623 Ga0466734_021821 Ga0466734_021821_2493_4370 625
351 2100351016 SWWA_contig00794__length_6125___numreads_127 SWWA_02457400 645

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06315 AceK_kinase Isocitrate dehydrogenase kinase/phosphatase (AceK) kinase domain 321 569 0.99
PF20423 AceK_regulatory Isocitrate dehydrogenase kinase/phosphatase (AceK), regulatory domain 21 320 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.