Protein Family IF00066
Metagenome
Isolate
351
Members
310
Samples
110
Scaffolds
587.22
Avg Length
Representative Sequence
- ID
- 2100351016|SWWA_contig00794__length_6125___numreads_127|SWWA_02457400
- Length
- 645 aa
- Sequence
- MRRLLFLAGVRMAAKLELLIAQTILQGFDAQYGRFLEVTAGAQQRFEQADWPAVQQAMKKRIHLYDHHVGLVVEQLKCITGQKYFDADFPSRVKAVYIDLLPDYPRFEIAESFFNSVYCRLFKHRDLTPDKLFVFSSQPERRFRDIPRPLARDFTPNGDLPAMLRSVLSDLPLRLPWEDLARDIRDITQALQRAFSAAQLAGATFQIANELFYRNKAAWLVGKLRLADGVYPFLLPIHHSESGALFIDACLTGKAEASIVFGFARSYFMVYAPLPAAMVEWLREILPGKTTAELYMAIGCQKHGKTECYREYLTFMAQSQEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKDEFAPQKEVTQAQVMACYQLVKEHDRVGRMADTQEYENFVVDKARLSTELLAELRREVPGKLEDLGDRIVIKHLYMERRMTPLNLYLEQANDQQMRDAIEEYGNAIKQLAAANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELASEPWYSIAPNDVFPEEFRHFLCGDRRIRRVFEELHSDLFTAEYWRGLQQRIREGTWKTCSLTARSSGSASAAGRRCRPPPLRCKSGLGARDGGARQFGDAGVVAAFQRVRRHQPGAADAQHAFQRQIAAVIVR
Sample Types
Isolate
68.7%
Metagenome
31.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.0%
Unclassified
11.8%
Anthocoridae
7.1%
Curculionidae
5.1%
Culicidae
4.7%
Termitidae
4.7%
Drosophilidae
4.4%
Muscidae
4.4%
Elmidae
4.4%
Formicidae
4.4%
Tenebrionidae
3.0%
Calliphoridae
2.7%
Armadillidiidae
1.7%
Cerambycidae
1.4%
Pteromalidae
1.0%
Tephritidae
1.0%
Apidae
1.0%
Aphididae
0.7%
Sarcophagidae
0.7%
Largidae
0.7%
Pentatomidae
0.7%
Plutellidae
0.7%
Berytidae
0.7%
Passalidae
0.7%
Alydidae
0.7%
Kalotermitidae
0.3%
Ceratophyllidae
0.3%
Trigoniulidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Reduviidae
0.3%
Rhopalidae
0.3%
Carabidae
0.3%
Lysianassidae
0.3%
Daphniidae
0.3%
Rhinotermitidae
0.3%
Hodotermitidae
0.3%
Siricidae
0.3%
Crambidae
0.3%
Taxonomy
Archaea
0
Bacteria
325
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 3 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 4 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 5 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 6 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 7 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 8 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 9 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 10 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 11 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 14 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 15 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 16 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 19 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 20 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 21 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 22 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 23 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 24 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 25 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 26 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 27 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 28 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 29 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 30 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 31 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 32 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 33 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 34 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 35 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 36 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 37 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 38 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 39 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 40 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 41 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 42 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 43 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 44 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 45 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 46 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 47 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 48 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 49 | 2958255616 | Serratia marcescens TM | Isolate | |
| 50 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 56 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 57 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 58 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 59 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 60 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 61 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 62 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 63 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 64 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 65 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 66 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 67 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 68 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 69 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 70 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 71 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 72 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 73 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 74 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 75 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 76 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 77 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 78 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 79 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 80 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 81 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 82 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 83 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 84 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 85 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 86 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 87 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 88 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 89 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 90 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 91 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 92 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 93 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 94 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 95 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 96 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 97 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 98 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 99 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 100 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 101 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 102 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 103 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 104 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 105 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 106 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 107 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 108 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 109 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 110 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 111 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 112 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 113 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 114 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 115 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 116 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 117 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 118 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 119 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 120 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 121 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 122 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 123 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 124 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 125 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 126 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 127 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 128 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 129 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 130 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 131 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 132 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 133 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 134 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 135 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 136 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 137 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 138 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 139 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 140 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 141 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 142 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 143 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 144 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 145 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 146 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 147 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 148 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 149 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 150 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 151 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 152 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 153 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 154 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 155 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 156 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 157 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 158 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 159 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 160 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 161 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 162 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 163 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 164 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 165 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 166 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 167 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 168 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 169 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 170 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 171 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 172 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 173 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 174 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 175 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 176 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 177 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 178 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 179 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 180 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 181 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 182 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 183 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 184 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 185 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 186 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 187 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 188 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 189 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 190 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 191 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 192 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 193 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 194 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 195 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 196 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 197 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 198 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 199 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 200 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 201 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 202 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 203 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 204 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 205 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 206 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 207 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 208 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 209 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 210 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 211 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 212 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 213 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 214 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 215 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 216 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 217 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 218 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 219 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 220 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 221 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 222 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 223 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 224 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 225 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 226 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 227 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 228 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 229 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 230 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 231 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 232 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 233 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 234 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 235 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 236 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 237 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 238 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 239 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 240 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 241 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 242 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 243 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 244 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 245 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 246 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 247 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 248 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 249 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 250 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 251 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 252 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 253 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 254 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 255 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 256 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 257 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 258 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 259 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 260 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 261 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 262 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 263 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 264 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 265 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 266 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 267 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 268 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 269 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 270 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 271 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 272 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 273 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 274 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 275 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 276 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 277 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 278 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 279 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 280 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 281 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 282 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 283 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 284 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 285 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 286 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 287 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 288 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 289 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 290 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 291 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 292 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 293 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 294 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 295 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 296 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 297 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 298 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 299 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 300 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 301 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 302 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 303 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 304 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 305 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 306 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 307 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 308 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 309 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 310 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160466_100127 | 3300012809 | Unclassified | 64497 |
| 2 | Ga0466730_005650 | 3300042625 | Bacteria | 17786 |
| 3 | Ga0466724_09210 | 3300042649 | Unclassified | 13277 |
| 4 | Ga0160443_100170 | 3300012848 | Bacteria | 88911 |
| 5 | Ga0265387_1000009 | 3300024582 | Bacteria | 83689 |
| 6 | SWWA_contig00794__length_6125___numreads_127 | 2100351016 | Bacteria | 6125 |
| 7 | Meta3P_1000666 | 3300002464 | Bacteria | 14190 |
| 8 | Meta3P_1008536 | 3300002464 | Unclassified | 13447 |
| 9 | CVPL010L_1000067 | 3300002932 | Bacteria | 46570 |
| 10 | Ga0063521_1000264 | 3300003973 | Bacteria | 34547 |
| 11 | Ga0104041_1001652 | 3300007106 | Unclassified | 10331 |
| 12 | Ga0103268_1001066 | 3300007192 | Unclassified | 7754 |
| 13 | Ga0466701_075792 | 3300042598 | Bacteria | 32408 |
| 14 | Ga0466730_042171 | 3300042625 | Unclassified | 17569 |
| 15 | Ga0466724_02107 | 3300042649 | Bacteria | 7369 |
| 16 | Ga0160440_100369 | 3300012815 | Bacteria | 18603 |
| 17 | Ga0160433_100684 | 3300012846 | Bacteria | 13166 |
| 18 | Ga0247290_00518 | 3300035364 | Unclassified | 6847 |
| 19 | Ga0466695_049312 | 3300042595 | Bacteria | 6467 |
| 20 | Ga0466710_075559 | 3300042613 | Bacteria | 7252 |
| 21 | DPOL_contig14916 | 2035918003 | Bacteria | 26157 |
| 22 | FGTW_contig30521 | 2065487013 | Bacteria | 19487 |
| 23 | IMNBGM34_c000780 | 3300000036 | Bacteria | 7452 |
| 24 | CVPL010W_10026823 | 3300002931 | Unclassified | 2620 |
| 25 | Ga0063521_1000349 | 3300003973 | Bacteria | 26705 |
| 26 | Ga0466701_081657 | 3300042598 | Bacteria | 94039 |
| 27 | Ga0123356_10006330 | 3300010049 | Bacteria | 11952 |
| 28 | Ga0466730_009828 | 3300042625 | Unclassified | 4939 |
| 29 | Ga0466724_11030 | 3300042649 | Bacteria | 52366 |
| 30 | Ga0466724_25632 | 3300042649 | Bacteria | 18768 |
| 31 | Ga0160469_100371 | 3300012824 | Bacteria | 24204 |
| 32 | Ga0160455_100190 | 3300012837 | Bacteria | 58190 |
| 33 | Ga0160472_100719 | 3300012839 | Bacteria | 15346 |
| 34 | Ga0160433_100434 | 3300012846 | Bacteria | 21669 |
| 35 | Ga0160443_100920 | 3300012848 | Unclassified | 13665 |
| 36 | Ga0103266_1000052 | 3300007067 | Bacteria | 50041 |
| 37 | Ga0104051_1019343 | 3300007078 | Unclassified | 4465 |
| 38 | Ga0102739_1000678 | 3300007095 | Bacteria | 6417 |
| 39 | Ga0103267_1000043 | 3300007190 | Bacteria | 94946 |
| 40 | Ga0466701_022040 | 3300042598 | Bacteria | 46095 |
| 41 | Ga0466707_354220 | 3300042601 | Unclassified | 7792 |
| 42 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 43 | Ga0466730_004904 | 3300042625 | Bacteria | 17999 |
| 44 | Ga0466724_19558 | 3300042649 | Bacteria | 94374 |
| 45 | Ga0160470_100216 | 3300012813 | Bacteria | 46291 |
| 46 | FGTW_contig31381 | 2065487013 | Unclassified | 4654 |
| 47 | Ga0063521_1000736 | 3300003973 | Bacteria | 12144 |
| 48 | Ga0072941_1572981 | 3300005201 | Bacteria | 2453 |
| 49 | Ga0105553_1034172 | 3300007767 | Bacteria | 10379 |
| 50 | Ga0160471_100072 | 3300012812 | Unclassified | 89657 |
| 51 | Ga0466724_07617 | 3300042649 | Bacteria | 46668 |
| 52 | Ga0160431_100328 | 3300012828 | Bacteria | 26267 |
| 53 | Ga0160447_100156 | 3300012849 | Bacteria | 45211 |
| 54 | Ga0160435_1008037 | 3300012857 | Unclassified | 2282 |
| 55 | Ga0247289_0053 | 3300035363 | Bacteria | 36283 |
| 56 | DPO_contig06476 | 2032320009 | Bacteria | 20432 |
| 57 | DPOL_contig17071 | 2035918003 | Unclassified | 9946 |
| 58 | Ga0074188_1000763 | 3300005318 | Bacteria | 10212 |
| 59 | Ga0103261_1002963 | 3300007083 | Bacteria | 2650 |
| 60 | Ga0562378_0299 | 3300056814 | Bacteria | 103228 |
| 61 | Ga0123357_10152984 | 3300009784 | Unclassified | 2792 |
| 62 | Ga0123354_10000044 | 3300010882 | Bacteria | 93974 |
| 63 | Ga0160465_100391 | 3300012803 | Unclassified | 23601 |
| 64 | Ga0160464_100061 | 3300012805 | Unclassified | 130455 |
| 65 | Ga0466730_035466 | 3300042625 | Bacteria | 27809 |
| 66 | Ga0466730_035978 | 3300042625 | Bacteria | 6470 |
| 67 | Ga0466724_45528 | 3300042649 | Bacteria | 53048 |
| 68 | Ga0160467_100961 | 3300012829 | Unclassified | 16384 |
| 69 | Ga0160447_109344 | 3300012849 | Unclassified | 2258 |
| 70 | Ga0160448_100031 | 3300012854 | Bacteria | 141009 |
| 71 | Ga0265387_1000294 | 3300024582 | Bacteria | 8418 |
| 72 | Ga0247290_00098 | 3300035364 | Bacteria | 27424 |
| 73 | Ga0466701_007049 | 3300042598 | Bacteria | 22470 |
| 74 | DPO_contig00368 | 2032320009 | Bacteria | 33940 |
| 75 | SPBB_contig00683 | 2044078006 | Bacteria | 163833 |
| 76 | SPBB_contig11507 | 2044078006 | Bacteria | 117601 |
| 77 | Ga0074188_1155265 | 3300005318 | Unclassified | 2745 |
| 78 | Ga0102734_1002296 | 3300007129 | Bacteria | 4525 |
| 79 | Ga0103264_1004624 | 3300007188 | Bacteria | 6479 |
| 80 | Ga0466701_045525 | 3300042598 | Bacteria | 19769 |
| 81 | Ga0466713_060579 | 3300042602 | Bacteria | 62557 |
| 82 | Ga0123355_10132557 | 3300009826 | Bacteria | 3835 |
| 83 | Ga0123356_10046457 | 3300010049 | Bacteria | 4039 |
| 84 | Ga0466734_021821 | 3300042623 | Bacteria | 5742 |
| 85 | Ga0466730_001800 | 3300042625 | Bacteria | 17667 |
| 86 | Ga0466724_16727 | 3300042649 | Unclassified | 117548 |
| 87 | Ga0466724_63383 | 3300042649 | Bacteria | 3324 |
| 88 | Ga0160446_102082 | 3300012835 | Bacteria | 3711 |
| 89 | Ga0160447_101779 | 3300012849 | Bacteria | 8066 |
| 90 | Ga0316159_10849 | 3300030930 | Bacteria | 4319 |
| 91 | Ga0466710_055253 | 3300042613 | Bacteria | 6790 |
| 92 | Ga0466715_143205 | 3300042616 | Bacteria | 113538 |
| 93 | 2227480188 | 2225789004 | Bacteria | 77366 |
| 94 | CVPL005W_1000353 | 3300002934 | Bacteria | 19720 |
| 95 | Ga0063521_1000731 | 3300003973 | Unclassified | 12280 |
| 96 | Ga0103265_1000937 | 3300007068 | Bacteria | 4824 |
| 97 | Ga0103264_1001274 | 3300007188 | Unclassified | 11100 |
| 98 | Ga0105005_1039051 | 3300007505 | Bacteria | 13538 |
| 99 | Ga0466701_068458 | 3300042598 | Bacteria | 165759 |
| 100 | Ga0466706_215617 | 3300042599 | Bacteria | 2464 |
| 101 | Ga0466733_103649 | 3300042659 | Bacteria | 4127 |
| 102 | Ga0562375_1509 | 3300056856 | Bacteria | 30851 |
| 103 | Ga0466725_270457 | 3300042654 | Bacteria | 24948 |
| 104 | Ga0160472_100375 | 3300012839 | Unclassified | 38306 |
| 105 | Ga0466657_212213 | 3300042582 | Bacteria | 50857 |
| 106 | Ga0466692_052496 | 3300042591 | Bacteria | 9743 |
| 107 | Ga0466693_234165 | 3300042592 | Bacteria | 4429 |
| 108 | Ga0103265_1000767 | 3300007068 | Bacteria | 5331 |
| 109 | Ga0102735_1001139 | 3300007080 | Bacteria | 5341 |
| 110 | Ga0466713_063427 | 3300042602 | Bacteria | 192176 |
Family Sequences
Functional Annotation
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k5l-assembly1.cif.gz_B | The crystal structure of isocitrate dehydrogenase kinase/phosphatase wtih two Mn2+ from E. coli | 0.992 | 16 | 566 |
| 3lcb-assembly2.cif.gz_B | The crystal structure of isocitrate dehydrogenase kinase/phosphatase in complex with its substrate, isocitrate dehydrogenase, from Escherichia coli. | 0.991 | 17 | 566 |
| 3lcb-assembly1.cif.gz_A | The crystal structure of isocitrate dehydrogenase kinase/phosphatase in complex with its substrate, isocitrate dehydrogenase, from Escherichia coli. | 0.99 | 16 | 566 |
| 4p69-assembly1.cif.gz_B | Acek (D477A) ICDH complex | 0.989 | 17 | 566 |
| 4p69-assembly1.cif.gz_A-2 | Acek (D477A) ICDH complex | 0.988 | 16 | 566 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P11071_9_567_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9933 | 21 | 566 | 1.10.510.10 |
| af_Q8I491_384_598_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9139 | 443 | 493 | 1.10.510.10 |
| af_Q8IFM1_383_622_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.887 | 430 | 493 | 1.10.510.10 |
| af_Q4CSB9_110_303_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8567 | 443 | 492 | 1.10.510.10 |
| 5oorA02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8543 | 441 | 493 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A485JQ07-F1-model_v4 | Uncharacterized/unreviewed | 0.9987 | 271 | 417 |
GO:0005737
GO:0008772 GO:0016208 GO:0005524 GO:0004721 GO:0004674 GO:0006006 GO:0006097 GO:0006099 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.