Protein Family IF00065

Metagenome Isolate
606 Members
516 Samples
182 Scaffolds
232.83 Avg Length

🧬 Representative Sequence

ID
2100351016|SWWA_contig00757__length_6462___numreads_142|SWWA_02326740
Length
249 aa
Sequence
MAKLTKRMRVIRDKVDATKQYDITEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKAAGAELVGMDDLADQIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKQNLLRRKACTSRKLASPPPWVLALLSIRAVCLLQRTNRICDYRFDLGPRFV

📊 Sample Types

Isolate 70.0%
Metagenome 30.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 29.7%
Unclassified 22.6%
Drosophilidae 5.5%
Anthocoridae 4.4%
Elmidae 3.8%
Termitidae 3.4%
Curculionidae 3.2%
Muscidae 2.6%
Formicidae 2.4%
Kalotermitidae 2.4%
Tenebrionidae 2.0%
Culicidae 1.8%
Calliphoridae 1.8%
Sarcophagidae 1.4%
Aphididae 1.2%
Tephritidae 1.0%
Termopsidae 0.8%
Rhinotermitidae 0.8%
Cerambycidae 0.8%
Aleyrodidae 0.6%
Palinuridae 0.6%
Talitridae 0.6%
Pteromalidae 0.6%
Armadillidiidae 0.4%
Pentatomidae 0.4%
Majidae 0.4%
Scarabaeidae 0.2%
Trigoniulidae 0.2%
Nephropidae 0.2%
Lysianassidae 0.2%
Aphalaridae 0.2%
Daphniidae 0.2%
Aphrophoridae 0.2%
Hodotermitidae 0.2%
Stratiomyidae 0.2%
Thripidae 0.2%
Anthomyiidae 0.2%
Artemiidae 0.2%
Reduviidae 0.2%
Rhopalidae 0.2%
Penaeidae 0.2%
Glossinidae 0.2%
Carabidae 0.2%
Siricidae 0.2%
Passalidae 0.2%
Crambidae 0.2%
Pseudococcidae 0.2%
Gryllidae 0.2%

🌳 Taxonomy

Archaea 0
Bacteria 557
Eukaryota 0
Viruses 0
Unclassified 49

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2511231129 Vibrio sp. EJY3 Isolate Unclassified
2 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
3 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
4 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
5 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
6 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
7 2645727860 Winslowiella iniecta B120 Isolate Aphididae
8 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
9 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
10 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
11 2703719240 Serratia marcescens ano2 Isolate Unclassified
12 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
13 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
14 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
15 2834098943 Gilliamella apis NO3 Isolate Apidae
16 2837560943 Snodgrassella alvi HK3 Isolate Apidae
17 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
18 2846366200 Snodgrassella alvi Gris3-4 Isolate Apidae
19 2846370940 Snodgrassella alvi Nev3CBA3 Isolate Apidae
20 2846480698 Gilliamella apis N-G4 Isolate Apidae
21 2846488152 Gilliamella apicola Bim3-2 Isolate Apidae
22 2849449383 Gilliamella apicola WF3-4 Isolate Apidae
23 2849458003 Gilliamella apicola HK7 Isolate Apidae
24 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
25 2857842411 Snodgrassella alvi Ruf1-X Isolate Apidae
26 2857876020 Gilliamella apicola Nev6-6 Isolate Apidae
27 2857881114 Gilliamella apis N-G3 Isolate Apidae
28 2868494745 Gilliamella apis NO1 Isolate Apidae
29 2870902796 Gilliamella apicola GillExp13 Isolate Apidae
30 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
31 2871771314 Pantoea sp. Ae16 Isolate Culicidae
32 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
33 2876016455 Gilliamella apicola N6 Isolate Apidae
34 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
35 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
36 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
37 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
38 2908136803 Vibrio owensii 1700302 Isolate Unclassified
39 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
40 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
41 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
42 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
43 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
44 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
45 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
46 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
47 3300000471 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 Metagenome Apidae
48 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
49 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
50 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
51 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
52 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
57 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
58 644736334 Candidatus Hamiltonella defensa 5AT Isolate Aphididae
59 648276708 Pantoea sp. aB Isolate Unclassified
60 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
61 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
62 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
63 8022345672 Vibrio sp. 070316B Isolate Unclassified
64 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
65 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
66 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
67 8088486376 Gilliamella apis ESL0172 Isolate Apidae
68 8101255641 Snodgrassella sp. M0110 Isolate Apidae
69 8101260589 Snodgrassella sp. M0118 Isolate Apidae
70 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
71 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
72 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
73 2509601000 Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 Isolate Aphalaridae
74 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
75 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
76 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
77 2548876931 Candidatus Hamiltonella defensa MED (Bemisia tabaci) Isolate Aleyrodidae
78 2574179716 Serratia sp. DD3 Isolate Daphniidae
79 2585428135 Sodalis-like symbiont of Philaenus spumarius PSPU Isolate Aphrophoridae
80 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
81 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
82 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
83 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
84 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
85 2684622921 Frischella perrara Fp_167 Isolate Unclassified
86 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
87 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
88 2718217944 Serratia marcescens AS1 Isolate Culicidae
89 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
90 2833532623 Frischella perrara ESL0167 Isolate Apidae
91 2840795165 Gilliamella apicola N-22 Isolate Apidae
92 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
93 2846483029 Gilliamella apis AM1 Isolate Apidae
94 2849466174 Gilliamella apis P83G Isolate Apidae
95 2854134697 Gilliamella apicola Fer4-1 Isolate Apidae
96 2854144746 Gilliamella apicola NO6 Isolate Apidae
97 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
98 2857827427 Snodgrassella alvi App6-4 Isolate Apidae
99 2857832487 Snodgrassella alvi HK9x Isolate Apidae
100 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
101 2857873190 Gilliamella apicola Nev5-1 Isolate Apidae
102 2857886120 Gilliamella apicola Bim1-2 Isolate Apidae
103 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
104 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
105 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
106 2864768727 Aeromonas veronii S00020 Isolate Elmidae
107 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
108 2868492035 Gilliamella apicola Occ4-3 Isolate Apidae
109 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
110 2876030618 Gilliamella apicola HK2 Isolate Apidae
111 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
112 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
113 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
114 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
115 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
116 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
117 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
118 3300000472 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 Metagenome Apidae
119 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
120 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
121 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
122 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
123 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
124 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
125 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
126 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
127 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
128 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
129 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
130 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
131 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
132 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
133 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
134 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
135 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
136 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
137 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
138 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
139 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
140 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
141 8100176769 Kosakonia sp. S57 Isolate Curculionidae
142 8101270055 Snodgrassella sp. W8124 Isolate Apidae
143 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
144 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
145 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
146 2585427850 Snodgrassella alvi wkB12 Isolate Apidae
147 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
148 2603880173 Pseudomonas SP. Isolate Unclassified
149 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
150 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
151 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
152 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
153 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
154 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
155 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
156 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
157 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
158 2841195917 Gilliamella apicola wkB7 Isolate Apidae
159 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
160 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
161 2849452216 Gilliamella apicola AW11 Isolate Apidae
162 2849455045 Gilliamella apicola NO8 Isolate Apidae
163 2850895757 Vibrio campbellii 170502 Isolate Unclassified
164 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
165 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
166 2868504459 Gilliamella apis NO4 Isolate Apidae
167 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
168 2870917785 Gilliamella apis NO15 Isolate Apidae
169 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
170 2872471378 Vibrio owensii V180403 Isolate Unclassified
171 2873636219 Gilliamella apicola App2-1 Isolate Apidae
172 2876033458 Gilliamella apicola AM6 Isolate Apidae
173 2876036378 Gilliamella apicola Choc3-5 Isolate Apidae
174 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
175 2878464769 Gilliamella apis ESL0169 Isolate Apidae
176 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
177 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
178 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
179 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
180 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
181 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
182 2958255616 Serratia marcescens TM Isolate
183 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
184 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
185 3300009478 Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov Metagenome
186 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
187 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
188 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
189 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
190 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
191 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
192 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
193 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
194 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
195 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
196 651324086 Plautia crossota stali symbiont Isolate Unclassified
197 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
198 8022087107 Vibrio sp. OULL4 Isolate Unclassified
199 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
200 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
201 8071333649 Escherichia coli PN108 Isolate Calliphoridae
202 8071338694 Escherichia coli PN87 Isolate Calliphoridae
203 8102982778 Erwinia sp. S63 Isolate Curculionidae
204 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
205 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
206 2510065003 Arsenophonus triatominarum ArT Isolate Reduviidae
207 2585428048 Colwellia sp. NBT2012 Isolate
208 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
209 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
210 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
211 2684622551 Vibrio campbellii E1 Isolate Unclassified
212 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
213 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
214 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
215 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
216 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
217 2834415282 Snodgrassella alvi Occ4-2 Isolate Apidae
218 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
219 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
220 2846472545 Gilliamella sp. N-W3 Isolate Apidae
221 2846475167 Gilliamella apicola N-G5 Isolate Apidae
222 2846493360 Gilliamella apis N-G1 Isolate Apidae
223 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
224 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
225 2857825141 Snodgrassella alvi wkB332 Isolate Apidae
226 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
227 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
228 2864791955 Aeromonas veronii S00030 Isolate Elmidae
229 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
230 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
231 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
232 2868464004 Snodgrassella alvi Pens2-2-5 Isolate Apidae
233 2870908367 Gilliamella apis NO13 Isolate Apidae
234 2870910722 Gilliamella apicola wkB112 Isolate Apidae
235 2873648542 Gilliamella apicola NO10 Isolate Apidae
236 2873653628 Gilliamella apicola App6-5 Isolate Apidae
237 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
238 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
239 2876014139 Gilliamella apicola wkB18 Isolate Apidae
240 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
241 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
242 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
243 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
244 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
245 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
246 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
247 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
248 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
249 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
250 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
251 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
252 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
253 3300010217 Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 Metagenome Aphididae
254 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
255 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
256 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
257 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
258 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
259 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
260 8022096067 Vibrio sp. SALL6 Isolate Unclassified
261 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
262 8051461712 Vibrio vulnificus Vv002 Isolate
263 8052469819 Pseudomonas putida DZ-F23 Isolate
264 8060845732 Vibrio vulnificus Vv006 Isolate
265 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
266 8071343737 Escherichia coli PN119 Isolate Calliphoridae
267 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
268 8101258116 Snodgrassella sp. M0112 Isolate Apidae
269 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
270 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
271 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
272 2515154034 Frischella perrara PEB0191 Isolate Apidae
273 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
274 2630968947 Frischella perrara PEB0191 Isolate Apidae
275 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
276 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
277 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
278 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
279 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
280 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
281 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
282 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
283 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
284 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
285 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
286 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
287 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
288 2846376288 Snodgrassella alvi Fer4-2 Isolate Apidae
289 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
290 2846490831 Gilliamella apis ESL0172 Isolate Apidae
291 2849399727 Snodgrassella alvi Fer1-2 Isolate Apidae
292 2849409164 Snodgrassella alvi wkB298 Isolate Apidae
293 2849446820 Gilliamella apicola Bif1-4 Isolate Apidae
294 2849468476 Gilliamella apicola N-28 Isolate Apidae
295 2854091108 Snodgrassella alvi wkB339 Isolate Apidae
296 2854129949 Gilliamella apis M1-2G Isolate Apidae
297 2854137290 Gilliamella apicola Imp1-6 Isolate Apidae
298 2854139540 Gilliamella apicola Imp1-1 Isolate Apidae
299 2857837414 Snodgrassella alvi App4-8 Isolate Apidae
300 2857883421 Gilliamella apicola N2 Isolate Apidae
301 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
302 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
303 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
304 2868169047 Comamonas aquatica S00077 Isolate Elmidae
305 2868486652 Gilliamella sp. N-G2 Isolate Apidae
306 2868506828 Gilliamella apicola App4-10 Isolate Apidae
307 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
308 2870900452 Gilliamella apis NO14 Isolate Apidae
309 2873640908 Gilliamella apicola wkB308 Isolate Apidae
310 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
311 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
312 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
313 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
314 2937735258 Serratia marcescens KZ11 Isolate Apidae
315 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
316 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
317 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
318 2978102237 Serratia fonticola AeS1 Isolate Culicidae
319 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
320 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
321 3007994558 Escherichia alba B35 Isolate Tenebrionidae
322 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
323 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
324 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
325 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
326 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
327 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
328 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
329 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
330 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
331 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
332 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
333 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
334 8100181737 Kosakonia sp. S58 Isolate Curculionidae
335 2515154048 Candidatus Gilliamella apicola wkB11 Isolate Apidae
336 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
337 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
338 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
339 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
340 2585427605 Colwellia sp. MT2012 Isolate
341 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
342 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
343 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
344 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
345 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
346 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
347 2791355473 Vibrio barjaei 3062 Isolate Unclassified
348 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
349 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
350 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
351 2846477985 Gilliamella apicola Fer1-1 Isolate Apidae
352 2848317263 Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF Isolate Aleyrodidae
353 2849404451 Snodgrassella alvi E1 Isolate Apidae
354 2849460838 Gilliamella apicola Gris3-2 Isolate Apidae
355 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
356 2854104879 Snodgrassella alvi Fer2-2 Isolate Apidae
357 2854127928 Gilliamella apicola Choc6-1 Isolate Apidae
358 2857868033 Gilliamella apis P62G Isolate Apidae
359 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
360 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
361 2868461634 Snodgrassella alvi Gris2-3-4 Isolate Apidae
362 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
363 2870905362 Gilliamella apicola Nev3-1 Isolate Apidae
364 2873645950 Gilliamella apicola Fer2-1 Isolate Apidae
365 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
366 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
367 2898975184 Erwinia dacicola IL Isolate Tephritidae
368 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
369 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
370 2978161719 Serratia marcescens KZ2 Isolate Apidae
371 3000861951 Budvicia diplopodorum D9 Isolate
372 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
373 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
374 3006242587 Vibrio sp. RE86 Isolate Unclassified
375 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
376 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
377 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
378 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
379 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
380 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
381 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
382 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
383 650716016 Candidatus Moranella endobia PCIT Isolate Pseudococcidae
384 8018312681 Enterobacter sp. OLF Isolate Tephritidae
385 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
386 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
387 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
388 8051534459 Vibrio vulnificus Vv004 Isolate
389 8065340634 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
390 8088488961 Gilliamella apis ESL0169 Isolate Apidae
391 8099192374 Erwinia typographi IC4 Isolate Curculionidae
392 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
393 2505679062 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
394 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
395 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
396 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
397 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
398 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
399 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
400 2785510746 Gilliamella sp. ESL0441 Isolate Apidae
401 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
402 2833859439 Arsenophonus endosymbiont of Aleurodicus dispersus ARAD Isolate Aleyrodidae
403 2836714267 Shimwellia blattae NCTC10965 Isolate
404 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
405 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
406 2843301220 Snodgrassella alvi Nev4-2 Isolate Apidae
407 2846363972 Snodgrassella alvi N-W7 Isolate Apidae
408 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
409 2846485327 Gilliamella apicola AM4 Isolate Apidae
410 2849471304 Gilliamella apicola NO5 Isolate Apidae
411 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
412 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
413 2873643457 Gilliamella apis A-4-12 Isolate Apidae
414 2876011797 Gilliamella apis NO16 Isolate Apidae
415 2876022486 Gilliamella apicola A8 Isolate Apidae
416 2876027665 Gilliamella apicola P54G Isolate Apidae
417 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
418 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
419 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
420 2971189173 Yersinia pestis A-1249 Isolate Unclassified
421 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
422 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
423 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
424 3300005314 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut Metagenome Drosophilidae
425 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
426 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
427 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
428 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
429 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
430 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
431 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
432 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
433 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
434 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
435 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
436 637000219 Pseudomonas entomophila L48 Isolate Unclassified
437 8021546568 Klebsiella sp. Kps Isolate Tephritidae
438 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
439 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
440 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
441 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
442 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
443 8071322446 Escherichia coli PN122 Isolate Calliphoridae
444 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
445 8100171289 Kosakonia sp. S42 Isolate Curculionidae
446 8101263066 Snodgrassella sp. M0351 Isolate Apidae
447 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
448 8103002986 Erwinia sp. S38 Isolate Curculionidae
449 8103008710 Erwinia sp. S43 Isolate Curculionidae
450 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
451 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
452 2515154049 Candidatus Gilliamella apicola wkB30 Isolate Apidae
453 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
454 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
455 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
456 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
457 2554235022 Vibrio parahaemolyticus v110 Isolate
458 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
459 2585427711 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
460 2585427851 Snodgrassella alvi wkB29 Isolate Apidae
461 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
462 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
463 2648501209 Winslowiella iniecta B149 Isolate Aphididae
464 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
465 2703719239 Serratia marcescens ano1 Isolate Unclassified
466 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
467 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
468 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
469 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
470 2846373876 Snodgrassella alvi Gris1-3 Isolate Apidae
471 2848751009 Snodgrassella alvi App2-2 Isolate Apidae
472 2854084220 Snodgrassella alvi Snod2-1-5 Isolate Apidae
473 2854102457 Snodgrassella alvi Gris1-6 Isolate Apidae
474 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
475 2854147632 Gilliamella apicola wkB195 Isolate Apidae
476 2857845033 Snodgrassella alvi WF3-3 Isolate Apidae
477 2857878760 Gilliamella apicola Gris1-4 Isolate Apidae
478 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
479 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
480 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
481 2868489326 Gilliamella apicola N10 Isolate Apidae
482 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
483 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
484 2870920129 Gilliamella apicola wkB108 Isolate Apidae
485 2873633977 Gilliamella apicola wkB178 Isolate Apidae
486 2873638493 Gilliamella apicola wkB72 Isolate Apidae
487 2873651485 Gilliamella apicola Choc4-2 Isolate Apidae
488 2876025319 Gilliamella apis NO12 Isolate Apidae
489 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
490 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
491 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
492 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
493 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
494 2912570088 Vibrio parahaemolyticus CHN25 Isolate
495 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
496 2986970932 Candidatus Fukatsuia symbiotica 5D Isolate Unclassified
497 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
498 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
499 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
500 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
501 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
502 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae
503 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
504 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
505 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
506 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
507 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
508 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
509 651285005 Serratia symbiotica Tuscon Isolate Aphididae
510 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
511 8004541719 Serratia marcescens KZ19 Isolate Apidae
512 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
513 8035422605 Pseudomonas monteilii CY06 Isolate
514 8051551332 Vibrio vulnificus Vv003 Isolate
515 8101274435 Snodgrassella sp. W8134 Isolate Apidae
516 8101276651 Snodgrassella sp. W8135 Isolate Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10064162 3300010049 Bacteria 3433
2 Ga0562377_0001 3300056842 Bacteria 5082480
3 Ga0466710_094963 3300042613 Bacteria 1848
4 Ga0466710_174796 3300042613 Bacteria 5110
5 Ga0466715_168909 3300042616 Bacteria 2268
6 Ga0466715_188360 3300042616 Bacteria 4144
7 Ga0466726_197069 3300042619 Bacteria 12655
8 Ga0466706_029080 3300042599 Bacteria 3413
9 Ga0466713_053525 3300042602 Unclassified 3289
10 Ga0466719_486193 3300042606 Bacteria 1498
11 Ga0466722_129668 3300042609 Bacteria 5075
12 SWWA_contig31944__length_3424___numreads_200 2100351016 Bacteria 3424
13 Ga0068305_10306353 3300005083 Unclassified 1473
14 Ga0074278_107915 3300005721 Bacteria 8064
15 Ga0104049_1137921 3300007103 Bacteria 992
16 Ga0104041_1032452 3300007106 Bacteria 11314
17 Ga0104019_1189993 3300007150 Bacteria 3024
18 Ga0105005_1082509 3300007505 Unclassified 7768
19 Ga0105005_1278873 3300007505 Bacteria 2299
20 Ga0105524_102375 3300007733 Bacteria 5956
21 Ga0127524_178098 3300009478 Bacteria 1164
22 Ga0160441_111273 3300012825 Unclassified 1052
23 Ga0466657_108160 3300042582 Bacteria 16433
24 Ga0466690_019836 3300042590 Bacteria 6253
25 Ga0466735_122292 3300042624 Bacteria 2396
26 Ga0466730_031310 3300042625 Bacteria 150332
27 Ga0466703_259944 3300042636 Bacteria 27101
28 Ga0466724_36307 3300042649 Bacteria 158990
29 Ga0466708_010991 3300042652 Bacteria 11017
30 Ga0466725_020645 3300042654 Unclassified 1428
31 Ga0123355_10118758 3300009826 Bacteria 4108
32 Ga0562378_0022 3300056814 Bacteria 672696
33 Ga0466712_153020 3300042614 Bacteria 5647
34 Ga0466723_178420 3300042618 Bacteria 5459
35 Ga0466701_054507 3300042598 Unclassified 2769
36 Ga0466707_059026 3300042601 Unclassified 5649
37 Ga0466707_070416 3300042601 Bacteria 77540
38 Ga0466714_012163 3300042603 Bacteria 1783
39 Ga0466719_167285 3300042606 Bacteria 7182
40 HBC_ctgsDRAFT_1028386 3300000333 Unclassified 1374
41 Ga0063521_1000120 3300003973 Bacteria 59713
42 Ga0102734_1000416 3300007129 Bacteria 12184
43 Ga0104040_1035472 3300007149 Bacteria 3075
44 Ga0103267_1000404 3300007190 Bacteria 14060
45 Ga0105005_1082772 3300007505 Unclassified 2158
46 Ga0127656_100105 3300009453 Bacteria 45606
47 Ga0127657_111844 3300009457 Bacteria 5841
48 Ga0466690_415645 3300042590 Bacteria 1725
49 Ga0466692_047041 3300042591 Bacteria 13657
50 Ga0466692_165952 3300042591 Bacteria 3488
51 Ga0466701_005002 3300042598 Bacteria 6930
52 Ga0466704_324912 3300042643 Unclassified 1161
53 Ga0466727_026338 3300042655 Bacteria 2674
54 Ga0123356_10041924 3300010049 Unclassified 4265
55 Ga0562379_0001 3300056790 Bacteria 4904077
56 Ga0562377_0002 3300056842 Bacteria 4351833
57 Ga0466726_370927 3300042619 Bacteria 1140
58 Ga0466701_095595 3300042598 Bacteria 3505
59 Ga0466719_102463 3300042606 Bacteria 3314
60 gam1t_NODE_697774_length=10685_GC=35_1_Contigs=7 2189573031 Bacteria 10745
61 SCG598O11_12230 3300000471 Bacteria 107509
62 SCG598L16_134585 3300000490 Bacteria 40638
63 CVPL005W_1000638 3300002934 Unclassified 12612
64 Ga0068302_10464553 3300005071 Bacteria 2233
65 Ga0074302_1033331 3300005316 Bacteria 3291
66 Ga0103266_1000120 3300007067 Bacteria 38540
67 Ga0104040_1142496 3300007149 Unclassified 2709
68 Ga0160468_100575 3300012819 Unclassified 13837
69 Ga0415639_190881 3300038395 Bacteria 1848
70 Ga0466734_106641 3300042623 Bacteria 3060
71 Ga0466703_293128 3300042636 Bacteria 3218
72 Ga0466724_31876 3300042649 Unclassified 3784
73 Ga0123355_10416996 3300009826 Bacteria 1719
74 Ga0562377_0013 3300056842 Bacteria 1229680
75 Ga0466705_353242 3300042612 Bacteria 39923
76 Ga0466710_016946 3300042613 Bacteria 6618
77 Ga0466711_023181 3300042615 Bacteria 3320
78 Ga0466711_177147 3300042615 Bacteria 7473
79 Ga0466711_424242 3300042615 Bacteria 4850
80 Ga0466728_117967 3300042620 Bacteria 18009
81 Ga0466701_044424 3300042598 Bacteria 22119
82 FGTW_contig30737 2065487013 Unclassified 10134
83 gam1t_NODE_593770_length=43570_GC=36_1_Contigs=1 2189573031 Bacteria 43570
84 2227302991 2225789004 Bacteria 30056
85 HBC_ctgsDRAFT_1000273 3300000333 Bacteria 11948
86 Ga0074302_1031568 3300005316 Unclassified 906
87 Ga0103265_1002939 3300007068 Unclassified 2577
88 Ga0102735_1000021 3300007080 Bacteria 54507
89 Ga0102740_1003849 3300007140 Unclassified 3099
90 Ga0103267_1000596 3300007190 Unclassified 10548
91 Ga0103268_1000203 3300007192 Bacteria 32563
92 Ga0316159_10002 3300030930 Bacteria 247683
93 Ga0466734_059648 3300042623 Bacteria 14587
94 Ga0466704_068158 3300042643 Bacteria 8115
95 Ga0466724_33061 3300042649 Bacteria 10924
96 Ga0466725_034927 3300042654 Bacteria 18676
97 Ga0466727_245442 3300042655 Bacteria 20970
98 Ga0123356_10360445 3300010049 Bacteria 1581
99 Ga0562374_0001 3300057007 Bacteria 4762007
100 Ga0466705_352026 3300042612 Bacteria 6215
101 Ga0466715_356726 3300042616 Bacteria 3722
102 Ga0466719_359350 3300042606 Bacteria 1615
103 SPBB_contig11649 2044078006 Unclassified 6774
104 gam1t_NODE_392340_length=7081_GC=35_6_Contigs=2 2189573031 Unclassified 7091
105 HBC_ctgsDRAFT_1015445 3300000333 Unclassified 1850
106 WW0001_100081 3300002732 Bacteria 214513
107 Ga0063521_1000313 3300003973 Bacteria 29434
108 Ga0104041_1124134 3300007106 Unclassified 903
109 Ga0160441_111256 3300012825 Unclassified 1053
110 Ga0160433_101543 3300012846 Unclassified 6148
111 Ga0466657_375608 3300042582 Bacteria 3714
112 Ga0466704_591825 3300042643 Unclassified 4044
113 Ga0466724_12131 3300042649 Unclassified 3029
114 Ga0136159_1000066 3300010217 Bacteria 97058
115 Ga0466723_113112 3300042618 Bacteria 15978
116 Ga0466729_196921 3300042621 Bacteria 13939
117 Ga0466713_073082 3300042602 Bacteria 8444
118 Ga0466713_114375 3300042602 Unclassified 3282
119 Ga0466719_101988 3300042606 Unclassified 3494
120 Ga0063521_1001404 3300003973 Bacteria 6676
121 Ga0074309_1001975 3300005314 Unclassified 2858
122 Ga0074188_1000785 3300005318 Bacteria 8554
123 Ga0102733_101184 3300006995 Unclassified 1594
124 Ga0102737_1002752 3300007142 Bacteria 4229
125 Ga0103264_1018676 3300007188 Unclassified 3383
126 Ga0104147_1031221 3300007224 Bacteria 10290
127 Ga0105553_1023974 3300007767 Unclassified 14819
128 Ga0127657_104882 3300009457 Bacteria 32634
129 Ga0160448_100189 3300012854 Unclassified 25936
130 Ga0466690_427016 3300042590 Bacteria 17189
131 Ga0466691_125132 3300042593 Bacteria 17265
132 Ga0466730_040928 3300042625 Bacteria 3887
133 Ga0466724_05511 3300042649 Unclassified 2789
134 Ga0466708_074047 3300042652 Bacteria 28825
135 Ga0466708_407205 3300042652 Bacteria 13399
136 Ga0466725_025725 3300042654 Bacteria 1527
137 Ga0123357_10007607 3300009784 Bacteria 13417
138 Ga0123353_10006445 3300010167 Unclassified 15620
139 Ga0562377_0003 3300056842 Bacteria 3990310
140 Ga0466726_336815 3300042619 Bacteria 12910
141 Ga0466729_053965 3300042621 Bacteria 4381
142 Ga0466701_051034 3300042598 Bacteria 2764
143 Ga0466707_116472 3300042601 Bacteria 15218
144 Ga0466707_215871 3300042601 Bacteria 2831
145 Ga0466719_337375 3300042606 Bacteria 15916
146 SPBB_contig11642 2044078006 Unclassified 8416
147 FGTW_contig30635 2065487013 Unclassified 13028
148 SCG598B02_11437 3300000472 Bacteria 26544
149 Meta3P_1002997 3300002464 Unclassified 1182
150 Ga0104044_1153011 3300007136 Unclassified 890
151 Ga0103267_1007438 3300007190 Bacteria 3187
152 Ga0265387_1000220 3300024582 Unclassified 9816
153 Ga0466657_019139 3300042582 Bacteria 2649
154 Ga0466692_099727 3300042591 Bacteria 7911
155 Ga0466730_027359 3300042625 Bacteria 2139
156 Ga0466704_254314 3300042643 Bacteria 1281
157 Ga0466709_215386 3300042648 Bacteria 5842
158 Ga0466724_58247 3300042649 Unclassified 13637
159 Ga0466708_090892 3300042652 Bacteria 12888
160 Ga0466725_087349 3300042654 Bacteria 25586
161 Ga0466733_021577 3300042659 Bacteria 12342
162 Ga0466697_182069 3300042611 Bacteria 3157
163 Ga0466726_132207 3300042619 Bacteria 4741
164 Ga0466701_041583 3300042598 Bacteria 9889
165 Ga0466701_060431 3300042598 Bacteria 3329
166 Ga0466707_032892 3300042601 Bacteria 15973
167 Ga0466717_305513 3300042604 Bacteria 1446
168 Ga0466719_025208 3300042606 Bacteria 11206
169 Ga0466719_291670 3300042606 Bacteria 7280
170 SWWA_contig00757__length_6462___numreads_142 2100351016 Bacteria 6462
171 HBC_ctgsDRAFT_1013439 3300000333 Unclassified 1971
172 SCG598I20_11809 3300000473 Unclassified 10125
173 Ga0063521_1020345 3300003973 Unclassified 1599
174 Ga0102734_1003151 3300007129 Bacteria 7255
175 Ga0104050_1003526 3300007153 Bacteria 2506
176 Ga0103267_1008156 3300007190 Bacteria 3085
177 Ga0160448_128272 3300012854 Unclassified 833
178 Ga0160435_1003941 3300012857 Unclassified 3472
179 Ga0466657_312701 3300042582 Bacteria 2610
180 Ga0466690_273225 3300042590 Bacteria 5414
181 Ga0466730_008492 3300042625 Bacteria 6038
182 Ga0466730_067021 3300042625 Unclassified 5696

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2894900265 2894902403 205
2 3300007103 Ga0104049_1137921 Ga0104049_11379212 213
3 3300005316 Ga0074302_1031568 Ga0074302_10315681 219
4 3300042625 Ga0466730_040928 Ga0466730_040928_2356_3063 219
5 3300042625 Ga0466730_031310 Ga0466730_031310_149271_149966 222
6 iso_pr_bacteria 2848317263 2848319497 225
7 3300009457 Ga0127657_104882 Ga0127657_10488218 226
8 3300042606 Ga0466719_486193 Ga0466719_486193_569_1255 228
9 3300009826 Ga0123355_10118758 Ga0123355_101187582 229
10 3300009826 Ga0123355_10416996 Ga0123355_104169962 229
11 3300010049 Ga0123356_10041924 Ga0123356_100419242 229
12 3300010049 Ga0123356_10360445 Ga0123356_103604452 229
13 3300042590 Ga0466690_415645 Ga0466690_415645_298_987 229
14 3300042591 Ga0466692_099727 Ga0466692_099727_5505_6194 229
15 3300042601 Ga0466707_059026 Ga0466707_059026_4012_4701 229
16 3300042606 Ga0466719_359350 Ga0466719_359350_393_1082 229
17 3300042615 Ga0466711_424242 Ga0466711_424242_1712_2401 229
18 3300042616 Ga0466715_188360 Ga0466715_188360_148_837 229
19 3300042618 Ga0466723_113112 Ga0466723_113112_1684_2373 229
20 3300042619 Ga0466726_132207 Ga0466726_132207_329_1018 229
21 3300042619 Ga0466726_336815 Ga0466726_336815_1718_2407 229
22 3300042619 Ga0466726_370927 Ga0466726_370927_129_818 229
23 3300042621 Ga0466729_053965 Ga0466729_053965_1754_2443 229
24 3300042636 Ga0466703_293128 Ga0466703_293128_1924_2613 229
25 3300042643 Ga0466704_254314 Ga0466704_254314_114_803 229
26 3300042643 Ga0466704_591825 Ga0466704_591825_3312_4001 229
27 3300042648 Ga0466709_215386 Ga0466709_215386_1539_2228 229
28 3300042652 Ga0466708_010991 Ga0466708_010991_8612_9301 229
29 3300042655 Ga0466727_026338 Ga0466727_026338_1547_2236 229
30 iso_pr_bacteria 2513237114 2513782526 229
31 iso_pr_bacteria 2831380896 2831381827 229
32 iso_pr_bacteria 2832037495 2832039325 229
33 iso_pr_bacteria 2832039703 2832041884 229
34 iso_pr_bacteria 8065338428 8065340266 229
35 iso_pr_bacteria 8065340634 8065341750 229
36 3300005071 Ga0068302_10464553 Ga0068302_104645532 230
37 3300042598 Ga0466701_041583 Ga0466701_041583_7112_7804 230
38 iso_pr_bacteria 2517487021 2517564471 230
39 iso_pr_bacteria 2791354930 2792024459 230
40 iso_pr_bacteria 648861007 648922284 230
41 2044078006 SPBB_contig11642 SPBB_667550 231
42 2044078006 SPBB_contig11649 SPBB_688010 231
43 2065487013 FGTW_contig30635 FGTW_02125990 231
44 2100351016 SWWA_contig31944__length_3424___numreads_200 SWWA_02991870 231
45 3300007150 Ga0104019_1189993 Ga0104019_11899933 231
46 3300009453 Ga0127656_100105 Ga0127656_10010538 231
47 3300038395 Ga0415639_190881 Ga0415639_190881_103_798 231
48 3300042582 Ga0466657_019139 Ga0466657_019139_450_1145 231
49 3300042582 Ga0466657_312701 Ga0466657_312701_196_891 231
50 3300042582 Ga0466657_375608 Ga0466657_375608_983_1678 231
51 3300042590 Ga0466690_019836 Ga0466690_019836_2745_3440 231
52 3300042590 Ga0466690_273225 Ga0466690_273225_1924_2619 231
53 3300042598 Ga0466701_005002 Ga0466701_005002_253_948 231
54 3300042598 Ga0466701_051034 Ga0466701_051034_1770_2465 231
55 3300042598 Ga0466701_054507 Ga0466701_054507_1772_2467 231
56 3300042601 Ga0466707_032892 Ga0466707_032892_13244_13939 231
57 3300042606 Ga0466719_101988 Ga0466719_101988_880_1575 231
58 3300042606 Ga0466719_102463 Ga0466719_102463_886_1581 231
59 3300042606 Ga0466719_167285 Ga0466719_167285_1717_2412 231
60 3300042609 Ga0466722_129668 Ga0466722_129668_1689_2384 231
61 3300042612 Ga0466705_352026 Ga0466705_352026_435_1130 231
62 3300042613 Ga0466710_094963 Ga0466710_094963_983_1678 231
63 3300042613 Ga0466710_174796 Ga0466710_174796_1415_2110 231
64 3300042623 Ga0466734_059648 Ga0466734_059648_12061_12756 231
65 3300042623 Ga0466734_106641 Ga0466734_106641_496_1191 231
66 3300042624 Ga0466735_122292 Ga0466735_122292_1656_2351 231
67 3300042625 Ga0466730_008492 Ga0466730_008492_3537_4232 231
68 3300042643 Ga0466704_324912 Ga0466704_324912_425_1120 231
69 3300042649 Ga0466724_36307 Ga0466724_36307_1924_2619 231
70 3300042652 Ga0466708_407205 Ga0466708_407205_10968_11663 231
71 3300042654 Ga0466725_020645 Ga0466725_020645_372_1067 231
72 3300042654 Ga0466725_087349 Ga0466725_087349_23093_23788 231
73 3300042655 Ga0466727_245442 Ga0466727_245442_18572_19267 231
74 3300042659 Ga0466733_021577 Ga0466733_021577_1730_2425 231
75 iso_pr_bacteria 2519899622 2520390351 231
76 iso_pr_bacteria 2571042003 2571062732 231
77 iso_pr_bacteria 2582581321 2585353526 231
78 iso_pr_bacteria 2585427850 2586973631 231
79 iso_pr_bacteria 2585427851 2586975689 231
80 iso_pr_bacteria 2603880173 2606036838 231
81 iso_pr_bacteria 2687453754 2690040789 231
82 iso_pr_bacteria 2687453755 2690043427 231
83 iso_pr_bacteria 2687453756 2690047739 231
84 iso_pr_bacteria 2820084079 2820086721 231
85 iso_pr_bacteria 2820103659 2820105840 231
86 iso_pr_bacteria 2820132692 2820134028 231
87 iso_pr_bacteria 2820152154 2820152809 231
88 iso_pr_bacteria 2833478085 2833478877 231
89 iso_pr_bacteria 2834415282 2834415478 231
90 iso_pr_bacteria 2837560943 2837561238 231
91 iso_pr_bacteria 2843301220 2843301346 231
92 iso_pr_bacteria 2846359427 2846359560 231
93 iso_pr_bacteria 2846363972 2846364492 231
94 iso_pr_bacteria 2846366200 2846366719 231
95 iso_pr_bacteria 2846370940 2846371008 231
96 iso_pr_bacteria 2846373876 2846373914 231
97 iso_pr_bacteria 2846376288 2846378577 231
98 iso_pr_bacteria 2846379220 2846380482 231
99 iso_pr_bacteria 2848751009 2848751359 231
100 iso_pr_bacteria 2849399727 2849399916 231
101 iso_pr_bacteria 2849404451 2849406271 231
102 iso_pr_bacteria 2849409164 2849409814 231
103 iso_pr_bacteria 2854084220 2854085470 231
104 iso_pr_bacteria 2854091108 2854091248 231
105 iso_pr_bacteria 2854102457 2854103197 231
106 iso_pr_bacteria 2854104879 2854105192 231
107 iso_pr_bacteria 2857825141 2857826279 231
108 iso_pr_bacteria 2857827427 2857830079 231
109 iso_pr_bacteria 2857832487 2857832500 231
110 iso_pr_bacteria 2857837414 2857838375 231
111 iso_pr_bacteria 2857842411 2857844776 231
112 iso_pr_bacteria 2857845033 2857846352 231
113 iso_pr_bacteria 2864739902 2864745121 231
114 iso_pr_bacteria 2864745180 2864750070 231
115 iso_pr_bacteria 2864751016 2864753458 231
116 iso_pr_bacteria 2864847319 2864853391 231
117 iso_pr_bacteria 2864853652 2864858786 231
118 iso_pr_bacteria 2864859030 2864862114 231
119 iso_pr_bacteria 2864903489 2864909856 231
120 iso_pr_bacteria 2864914039 2864917110 231
121 iso_pr_bacteria 2864926767 2864931658 231
122 iso_pr_bacteria 2864944480 2864948199 231
123 iso_pr_bacteria 2864988360 2864991027 231
124 iso_pr_bacteria 2868169047 2868172160 231
125 iso_pr_bacteria 2868461634 2868463144 231
126 iso_pr_bacteria 2868464004 2868466347 231
127 iso_pr_bacteria 2870361953 2870364883 231
128 iso_pr_bacteria 2987233858 2987234070 231
129 iso_pr_bacteria 2990166910 2990168916 231
130 iso_pr_bacteria 2997878596 2997881845 231
131 iso_pr_bacteria 3000478755 3000481516 231
132 iso_pr_bacteria 3007473699 3007474964 231
133 iso_pr_bacteria 3007478678 3007484000 231
134 iso_pr_bacteria 637000219 637999601 231
135 iso_pr_bacteria 8011329375 8011334645 231
136 iso_pr_bacteria 8011357093 8011361209 231
137 iso_pr_bacteria 8035321120 8035323052 231
138 iso_pr_bacteria 8035326735 8035327803 231
139 iso_pr_bacteria 8035422605 8035423173 231
140 iso_pr_bacteria 8052469819 8052474953 231
141 iso_pr_bacteria 8101255641 8101255885 231
142 iso_pr_bacteria 8101258116 8101258281 231
143 iso_pr_bacteria 8101260589 8101260823 231
144 iso_pr_bacteria 8101263066 8101265282 231
145 iso_pr_bacteria 8101270055 8101272216 231
146 iso_pr_bacteria 8101274435 8101274443 231
147 iso_pr_bacteria 8101276651 8101276659 231
148 3300000333 HBC_ctgsDRAFT_1000273 HBC_ctgsDRAFT_100027312 232
149 3300000333 HBC_ctgsDRAFT_1028386 HBC_ctgsDRAFT_10283861 232
150 3300000471 SCG598O11_12230 SCG598O11_12230102 232
151 3300002934 CVPL005W_1000638 CVPL005W_10006386 232
152 3300005721 Ga0074278_107915 Ga0074278_1079154 232
153 3300006995 Ga0102733_101184 Ga0102733_1011842 232
154 3300007067 Ga0103266_1000120 Ga0103266_10001206 232
155 3300007068 Ga0103265_1002939 Ga0103265_10029391 232
156 3300007080 Ga0102735_1000021 Ga0102735_100002140 232
157 3300007129 Ga0102734_1000416 Ga0102734_10004166 232
158 3300007129 Ga0102734_1003151 Ga0102734_10031514 232
159 3300007140 Ga0102740_1003849 Ga0102740_10038492 232
160 3300007142 Ga0102737_1002752 Ga0102737_10027526 232
161 3300007153 Ga0104050_1003526 Ga0104050_10035264 232
162 3300007188 Ga0103264_1018676 Ga0103264_10186766 232
163 3300007190 Ga0103267_1000404 Ga0103267_10004046 232
164 3300007190 Ga0103267_1000596 Ga0103267_10005966 232
165 3300007192 Ga0103268_1000203 Ga0103268_100020325 232
166 3300007505 Ga0105005_1082772 Ga0105005_10827723 232
167 3300007733 Ga0105524_102375 Ga0105524_1023756 232
168 3300009478 Ga0127524_178098 Ga0127524_1780981 232
169 3300009784 Ga0123357_10007607 Ga0123357_100076076 232
170 3300010049 Ga0123356_10064162 Ga0123356_100641626 232
171 3300010167 Ga0123353_10006445 Ga0123353_100064459 232
172 3300012825 Ga0160441_111256 Ga0160441_1112562 232
173 3300012825 Ga0160441_111273 Ga0160441_1112732 232
174 3300012846 Ga0160433_101543 Ga0160433_1015436 232
175 3300012854 Ga0160448_128272 Ga0160448_1282721 232
176 3300012857 Ga0160435_1003941 Ga0160435_10039411 232
177 3300042590 Ga0466690_427016 Ga0466690_427016_14763_15461 232
178 3300042593 Ga0466691_125132 Ga0466691_125132_14850_15548 232
179 3300042599 Ga0466706_029080 Ga0466706_029080_1723_2421 232
180 3300042602 Ga0466713_073082 Ga0466713_073082_5766_6464 232
181 3300042606 Ga0466719_291670 Ga0466719_291670_4709_5407 232
182 3300042606 Ga0466719_337375 Ga0466719_337375_12022_12720 232
183 3300042614 Ga0466712_153020 Ga0466712_153020_1639_2337 232
184 3300042615 Ga0466711_023181 Ga0466711_023181_191_889 232
185 3300042616 Ga0466715_168909 Ga0466715_168909_1185_1883 232
186 3300042618 Ga0466723_178420 Ga0466723_178420_1760_2458 232
187 3300042619 Ga0466726_197069 Ga0466726_197069_2015_2713 232
188 3300042620 Ga0466728_117967 Ga0466728_117967_1784_2482 232
189 3300042636 Ga0466703_259944 Ga0466703_259944_24638_25336 232
190 iso_pr_bacteria 2501651205 2501715834 232
191 iso_pr_bacteria 2585427605 2585889775 232
192 iso_pr_bacteria 2585428048 2587694476 232
193 iso_pr_bacteria 2820050117 2820050521 232
194 iso_pr_bacteria 2864808494 2864809004 232
195 iso_pr_bacteria 2864812326 2864812836 232
196 iso_pr_bacteria 2891720358 2891723402 232
197 iso_pr_bacteria 2986970932 2986973327 232
198 2189573031 gam1t_NODE_392340_length=7081_GC=35_6_Contigs=2 gam1t_00103810 233
199 2189573031 gam1t_NODE_593770_length=43570_GC=36_1_Contigs=1 gam1t_00171750 233
200 2189573031 gam1t_NODE_697774_length=10685_GC=35_1_Contigs=7 gam1t_00043960 233
201 3300005083 Ga0068305_10306353 Ga0068305_103063532 233
202 3300007190 Ga0103267_1007438 Ga0103267_10074383 233
203 3300007190 Ga0103267_1008156 Ga0103267_10081561 233
204 3300030930 Ga0316159_10002 Ga0316159_1000284 233
205 3300042598 Ga0466701_044424 Ga0466701_044424_2124_2825 233
206 3300042603 Ga0466714_012163 Ga0466714_012163_254_955 233
207 3300042606 Ga0466719_025208 Ga0466719_025208_9958_10659 233
208 3300042612 Ga0466705_353242 Ga0466705_353242_1705_2406 233
209 3300042616 Ga0466715_356726 Ga0466715_356726_1689_2390 233
210 3300042621 Ga0466729_196921 Ga0466729_196921_1841_2542 233
211 3300042625 Ga0466730_027359 Ga0466730_027359_406_1107 233
212 3300042643 Ga0466704_068158 Ga0466704_068158_1814_2515 233
213 3300042649 Ga0466724_58247 Ga0466724_58247_3106_3807 233
214 3300042652 Ga0466708_074047 Ga0466708_074047_25671_26372 233
215 3300042652 Ga0466708_090892 Ga0466708_090892_10320_11021 233
216 iso_pr_bacteria 2510065002 2510073025 233
217 iso_pr_bacteria 2510065003 2510073850 233
218 iso_pr_bacteria 2511231129 2511732485 233
219 iso_pr_bacteria 2515154034 2515297966 233
220 iso_pr_bacteria 2515154047 2515333134 233
221 iso_pr_bacteria 2515154048 2515334296 233
222 iso_pr_bacteria 2515154049 2515336897 233
223 iso_pr_bacteria 2518285522 2518344251 233
224 iso_pr_bacteria 2524614872 2526113776 233
225 iso_pr_bacteria 2529292851 2530235376 233
226 iso_pr_bacteria 2531839005 2531868945 233
227 iso_pr_bacteria 2548876931 2550376890 233
228 iso_pr_bacteria 2551306507 2553349841 233
229 iso_pr_bacteria 2554235022 2554339087 233
230 iso_pr_bacteria 2565956518 2566028080 233
231 iso_pr_bacteria 2571042430 2572516082 233
232 iso_pr_bacteria 2571042554 2572929126 233
233 iso_pr_bacteria 2597489902 2597919936 233
234 iso_pr_bacteria 2597489903 2597924005 233
235 iso_pr_bacteria 2599185261 2599816180 233
236 iso_pr_bacteria 2600255074 2600849100 233
237 iso_pr_bacteria 2630968947 2633887612 233
238 iso_pr_bacteria 2636415586 2637166652 233
239 iso_pr_bacteria 2648501158 2648751912 233
240 iso_pr_bacteria 2654587515 2654662854 233
241 iso_pr_bacteria 2663763317 2666535417 233
242 iso_pr_bacteria 2667527830 2669652469 233
243 iso_pr_bacteria 2667527887 2669889729 233
244 iso_pr_bacteria 2684622551 2684819255 233
245 iso_pr_bacteria 2684622921 2686092167 233
246 iso_pr_bacteria 2684622922 2686094430 233
247 iso_pr_bacteria 2684622923 2686096877 233
248 iso_pr_bacteria 2684622924 2686099693 233
249 iso_pr_bacteria 2684622925 2686102317 233
250 iso_pr_bacteria 2693429575 2693744535 233
251 iso_pr_bacteria 2700989396 2702443569 233
252 iso_pr_bacteria 2731957638 2732533087 233
253 iso_pr_bacteria 2731957969 2734003425 233
254 iso_pr_bacteria 2756170265 2756752572 233
255 iso_pr_bacteria 2756170266 2756754904 233
256 iso_pr_bacteria 2756170277 2756800387 233
257 iso_pr_bacteria 2785510744 2785737241 233
258 iso_pr_bacteria 2785510745 2785739713 233
259 iso_pr_bacteria 2785510746 2785742129 233
260 iso_pr_bacteria 2785510747 2785744574 233
261 iso_pr_bacteria 2785510762 2785801721 233
262 iso_pr_bacteria 2791355471 2794375749 233
263 iso_pr_bacteria 2791355473 2794384893 233
264 iso_pr_bacteria 2833532623 2833534654 233
265 iso_pr_bacteria 2833859439 2833859906 233
266 iso_pr_bacteria 2834098943 2834101116 233
267 iso_pr_bacteria 2836755666 2836760033 233
268 iso_pr_bacteria 2837615801 2837618363 233
269 iso_pr_bacteria 2837618715 2837620519 233
270 iso_pr_bacteria 2838840603 2838842590 233
271 iso_pr_bacteria 2840795165 2840796380 233
272 iso_pr_bacteria 2840797934 2840798687 233
273 iso_pr_bacteria 2841195917 2841197094 233
274 iso_pr_bacteria 2841260384 2841263577 233
275 iso_pr_bacteria 2841821538 2841823502 233
276 iso_pr_bacteria 2843334863 2843336027 233
277 iso_pr_bacteria 2843337836 2843339218 233
278 iso_pr_bacteria 2846472545 2846474577 233
279 iso_pr_bacteria 2846475167 2846477739 233
280 iso_pr_bacteria 2846477985 2846478944 233
281 iso_pr_bacteria 2846480698 2846482046 233
282 iso_pr_bacteria 2846483029 2846484383 233
283 iso_pr_bacteria 2846485327 2846486642 233
284 iso_pr_bacteria 2846488152 2846490565 233
285 iso_pr_bacteria 2846490831 2846493060 233
286 iso_pr_bacteria 2846493360 2846495456 233
287 iso_pr_bacteria 2846495668 2846497985 233
288 iso_pr_bacteria 2849446820 2849447144 233
289 iso_pr_bacteria 2849449383 2849449756 233
290 iso_pr_bacteria 2849452216 2849454311 233
291 iso_pr_bacteria 2849455045 2849456004 233
292 iso_pr_bacteria 2849458003 2849459615 233
293 iso_pr_bacteria 2849460838 2849461751 233
294 iso_pr_bacteria 2849463436 2849465535 233
295 iso_pr_bacteria 2849466174 2849467754 233
296 iso_pr_bacteria 2849468476 2849468590 233
297 iso_pr_bacteria 2849471304 2849473478 233
298 iso_pr_bacteria 2850131454 2850135795 233
299 iso_pr_bacteria 2850895757 2850898852 233
300 iso_pr_bacteria 2854127928 2854129368 233
301 iso_pr_bacteria 2854129949 2854131823 233
302 iso_pr_bacteria 2854134697 2854137208 233
303 iso_pr_bacteria 2854137290 2854139266 233
304 iso_pr_bacteria 2854139540 2854141820 233
305 iso_pr_bacteria 2854141978 2854144370 233
306 iso_pr_bacteria 2854144746 2854147090 233
307 iso_pr_bacteria 2854147632 2854147748 233
308 iso_pr_bacteria 2854149989 2854151831 233
309 iso_pr_bacteria 2857868033 2857869158 233
310 iso_pr_bacteria 2857870431 2857872365 233
311 iso_pr_bacteria 2857873190 2857875209 233
312 iso_pr_bacteria 2857876020 2857876447 233
313 iso_pr_bacteria 2857878760 2857880660 233
314 iso_pr_bacteria 2857881114 2857883303 233
315 iso_pr_bacteria 2857883421 2857885747 233
316 iso_pr_bacteria 2857886120 2857886828 233
317 iso_pr_bacteria 2857888719 2857891486 233
318 iso_pr_bacteria 2860776474 2860776481 233
319 iso_pr_bacteria 2864764899 2864767831 233
320 iso_pr_bacteria 2864768727 2864772265 233
321 iso_pr_bacteria 2864777284 2864782111 233
322 iso_pr_bacteria 2864791955 2864795494 233
323 iso_pr_bacteria 2864796242 2864800988 233
324 iso_pr_bacteria 2868486652 2868489093 233
325 iso_pr_bacteria 2868489326 2868489843 233
326 iso_pr_bacteria 2868492035 2868492978 233
327 iso_pr_bacteria 2868494745 2868495480 233
328 iso_pr_bacteria 2868497104 2868499025 233
329 iso_pr_bacteria 2868499409 2868502257 233
330 iso_pr_bacteria 2868504459 2868505908 233
331 iso_pr_bacteria 2870897478 2870900143 233
332 iso_pr_bacteria 2870900452 2870902375 233
333 iso_pr_bacteria 2870902796 2870904426 233
334 iso_pr_bacteria 2870905362 2870907717 233
335 iso_pr_bacteria 2870908367 2870910528 233
336 iso_pr_bacteria 2870910722 2870912905 233
337 iso_pr_bacteria 2870913170 2870914873 233
338 iso_pr_bacteria 2870915472 2870917135 233
339 iso_pr_bacteria 2870917785 2870920006 233
340 iso_pr_bacteria 2870920129 2870921457 233
341 iso_pr_bacteria 2872471378 2872474675 233
342 iso_pr_bacteria 2873633977 2873635901 233
343 iso_pr_bacteria 2873638493 2873640794 233
344 iso_pr_bacteria 2873640908 2873643367 233
345 iso_pr_bacteria 2873643457 2873645407 233
346 iso_pr_bacteria 2873645950 2873646316 233
347 iso_pr_bacteria 2873645950 2873646435 233
348 iso_pr_bacteria 2873648542 2873648599 233
349 iso_pr_bacteria 2873651485 2873651796 233
350 iso_pr_bacteria 2873653628 2873655845 233
351 iso_pr_bacteria 2873656248 2873657742 233
352 iso_pr_bacteria 2875320051 2875320260 233
353 iso_pr_bacteria 2876011797 2876013855 233
354 iso_pr_bacteria 2876014139 2876016266 233
355 iso_pr_bacteria 2876016455 2876019049 233
356 iso_pr_bacteria 2876022486 2876023429 233
357 iso_pr_bacteria 2876025319 2876026746 233
358 iso_pr_bacteria 2876027665 2876030390 233
359 iso_pr_bacteria 2876030618 2876032092 233
360 iso_pr_bacteria 2876033458 2876035352 233
361 iso_pr_bacteria 2876036378 2876037845 233
362 iso_pr_bacteria 2877638525 2877640691 233
363 iso_pr_bacteria 2877647439 2877647470 233
364 iso_pr_bacteria 2878462549 2878463159 233
365 iso_pr_bacteria 2878464769 2878466741 233
366 iso_pr_bacteria 2896187957 2896191064 233
367 iso_pr_bacteria 2908136803 2908136969 233
368 iso_pr_bacteria 2912570088 2912573154 233
369 iso_pr_bacteria 2997380424 2997380654 233
370 iso_pr_bacteria 3003178663 3003181299 233
371 iso_pr_bacteria 3006225627 3006228659 233
372 iso_pr_bacteria 644736334 644772296 233
373 iso_pr_bacteria 8008122225 8008126489 233
374 iso_pr_bacteria 8022087107 8022089709 233
375 iso_pr_bacteria 8022096067 8022099108 233
376 iso_pr_bacteria 8022439116 8022442318 233
377 iso_pr_bacteria 8033364368 8033364871 233
378 iso_pr_bacteria 8033368880 8033372218 233
379 iso_pr_bacteria 8042061949 8042065597 233
380 iso_pr_bacteria 8051461712 8051461743 233
381 iso_pr_bacteria 8051534459 8051535769 233
382 iso_pr_bacteria 8051551332 8051552985 233
383 iso_pr_bacteria 8060845732 8060849564 233
384 iso_pr_bacteria 8088486376 8088486933 233
385 iso_pr_bacteria 8088488961 8088489468 233
386 iso_pr_bacteria 8088491222 8088491793 233
387 iso_pr_bacteria 8101676404 8101676435 233
388 iso_pr_bacteria 8101680043 8101680200 233
389 iso_pr_bacteria 8101683685 8101687282 233
390 2065487013 FGTW_contig30737 FGTW_02931340 234
391 2225789004 2227302991 2227752673 234
392 3300000333 HBC_ctgsDRAFT_1015445 HBC_ctgsDRAFT_10154452 234
393 3300000472 SCG598B02_11437 SCG598B02_1143728 234
394 3300000473 SCG598I20_11809 SCG598I20_118095 234
395 3300000490 SCG598L16_134585 SCG598L16_13458516 234
396 3300002732 WW0001_100081 WW0001_100081197 234
397 3300003973 Ga0063521_1000120 Ga0063521_10001205 234
398 3300003973 Ga0063521_1001404 Ga0063521_10014044 234
399 3300007505 Ga0105005_1278873 Ga0105005_12788731 234
400 3300010217 Ga0136159_1000066 Ga0136159_100006678 234
401 3300024582 Ga0265387_1000220 Ga0265387_10002205 234
402 3300042591 Ga0466692_047041 Ga0466692_047041_1715_2419 234
403 3300042601 Ga0466707_215871 Ga0466707_215871_1944_2648 234
404 3300042602 Ga0466713_053525 Ga0466713_053525_1967_2671 234
405 3300042602 Ga0466713_114375 Ga0466713_114375_1917_2621 234
406 3300042615 Ga0466711_177147 Ga0466711_177147_350_1054 234
407 3300042625 Ga0466730_067021 Ga0466730_067021_2007_2711 234
408 3300042649 Ga0466724_05511 Ga0466724_05511_1980_2684 234
409 3300042649 Ga0466724_12131 Ga0466724_12131_106_810 234
410 3300042649 Ga0466724_31876 Ga0466724_31876_1903_2607 234
411 3300056790 Ga0562379_0001 Ga0562379_0001_25858_26562 234
412 3300056814 Ga0562378_0022 Ga0562378_0022_36947_37651 234
413 3300056842 Ga0562377_0001 Ga0562377_0001_3476383_3477087 234
414 3300056842 Ga0562377_0002 Ga0562377_0002_1715784_1716488 234
415 3300056842 Ga0562377_0003 Ga0562377_0003_879338_880042 234
416 3300056842 Ga0562377_0013 Ga0562377_0013_698856_699560 234
417 3300057007 Ga0562374_0001 Ga0562374_0001_2478175_2478879 234
418 iso_pr_bacteria 2505679062 2505924201 234
419 iso_pr_bacteria 2507262057 2507518986 234
420 iso_pr_bacteria 2509601000 2509601275 234
421 iso_pr_bacteria 2537561600 2537928120 234
422 iso_pr_bacteria 2547132185 2547709666 234
423 iso_pr_bacteria 2551306516 2553378491 234
424 iso_pr_bacteria 2551306520 2553401863 234
425 iso_pr_bacteria 2551306531 2553450992 234
426 iso_pr_bacteria 2574179716 2574245949 234
427 iso_pr_bacteria 2585427711 2586306017 234
428 iso_pr_bacteria 2585428135 2588035573 234
429 iso_pr_bacteria 2588253732 2588527155 234
430 iso_pr_bacteria 2588253791 2588727947 234
431 iso_pr_bacteria 2609459925 2610644121 234
432 iso_pr_bacteria 2609459958 2610824676 234
433 iso_pr_bacteria 2619619082 2620614257 234
434 iso_pr_bacteria 2627853677 2628495626 234
435 iso_pr_bacteria 2627854002 2629835648 234
436 iso_pr_bacteria 2630968716 2632958289 234
437 iso_pr_bacteria 2636415542 2636991505 234
438 iso_pr_bacteria 2645727860 2647290075 234
439 iso_pr_bacteria 2648501209 2648986831 234
440 iso_pr_bacteria 2648501820 2651394694 234
441 iso_pr_bacteria 2651870110 2653798161 234
442 iso_pr_bacteria 2671180705 2673867538 234
443 iso_pr_bacteria 2703719239 2706053885 234
444 iso_pr_bacteria 2703719240 2706059164 234
445 iso_pr_bacteria 2711768158 2712482136 234
446 iso_pr_bacteria 2718217944 2719460473 234
447 iso_pr_bacteria 2765235945 2766081552 234
448 iso_pr_bacteria 2778261152 2779036993 234
449 iso_pr_bacteria 2778261153 2779045223 234
450 iso_pr_bacteria 2822856742 2822856972 234
451 iso_pr_bacteria 2824588292 2824593027 234
452 iso_pr_bacteria 2833053935 2833056680 234
453 iso_pr_bacteria 2835335304 2835337469 234
454 iso_pr_bacteria 2837516909 2837521909 234
455 iso_pr_bacteria 2844251356 2844252992 234
456 iso_pr_bacteria 2846386538 2846389236 234
457 iso_pr_bacteria 2847708326 2847708430 234
458 iso_pr_bacteria 2856068565 2856069877 234
459 iso_pr_bacteria 2858407585 2858409245 234
460 iso_pr_bacteria 2859315706 2859319500 234
461 iso_pr_bacteria 2868506828 2868507883 234
462 iso_pr_bacteria 2868883784 2868885706 234
463 iso_pr_bacteria 2871760914 2871761358 234
464 iso_pr_bacteria 2871771314 2871772892 234
465 iso_pr_bacteria 2873636219 2873637308 234
466 iso_pr_bacteria 2873884416 2873885339 234
467 iso_pr_bacteria 2874434233 2874437317 234
468 iso_pr_bacteria 2874504452 2874508160 234
469 iso_pr_bacteria 2874880541 2874883460 234
470 iso_pr_bacteria 2876334352 2876338806 234
471 iso_pr_bacteria 2876358570 2876362541 234
472 iso_pr_bacteria 2878947168 2878947999 234
473 iso_pr_bacteria 2885043073 2885045696 234
474 iso_pr_bacteria 2885046828 2885049319 234
475 iso_pr_bacteria 2885050628 2885053217 234
476 iso_pr_bacteria 2885054481 2885056973 234
477 iso_pr_bacteria 2885058212 2885060582 234
478 iso_pr_bacteria 2885061987 2885064500 234
479 iso_pr_bacteria 2885065815 2885068310 234
480 iso_pr_bacteria 2896925746 2896927659 234
481 iso_pr_bacteria 2898975184 2898978677 234
482 iso_pr_bacteria 2898991528 2898991839 234
483 iso_pr_bacteria 2900349738 2900352293 234
484 iso_pr_bacteria 2901296437 2901297799 234
485 iso_pr_bacteria 2902438364 2902441697 234
486 iso_pr_bacteria 2902451016 2902452526 234
487 iso_pr_bacteria 2902469402 2902471055 234
488 iso_pr_bacteria 2902896024 2902897812 234
489 iso_pr_bacteria 2902916284 2902917274 234
490 iso_pr_bacteria 2912636047 2912636554 234
491 iso_pr_bacteria 2921816052 2921818188 234
492 iso_pr_bacteria 2921842437 2921846349 234
493 iso_pr_bacteria 2922113941 2922117311 234
494 iso_pr_bacteria 2937427229 2937427735 234
495 iso_pr_bacteria 2937735258 2937737529 234
496 iso_pr_bacteria 2937751072 2937754482 234
497 iso_pr_bacteria 2957730672 2957732081 234
498 iso_pr_bacteria 2958255616 2958257225 234
499 iso_pr_bacteria 2961206375 2961209118 234
500 iso_pr_bacteria 2961232173 2961235819 234
501 iso_pr_bacteria 2961247850 2961248635 234
502 iso_pr_bacteria 2964846109 2964848931 234
503 iso_pr_bacteria 2964859436 2964863034 234
504 iso_pr_bacteria 2965197371 2965201363 234
505 iso_pr_bacteria 2967915117 2967919005 234
506 iso_pr_bacteria 2967924226 2967928127 234
507 iso_pr_bacteria 2970322301 2970326741 234
508 iso_pr_bacteria 2970335472 2970337827 234
509 iso_pr_bacteria 2970791725 2970795547 234
510 iso_pr_bacteria 2971189173 2971191882 234
511 iso_pr_bacteria 2977691992 2977694891 234
512 iso_pr_bacteria 2977727922 2977730391 234
513 iso_pr_bacteria 2977745872 2977748660 234
514 iso_pr_bacteria 2978102237 2978105407 234
515 iso_pr_bacteria 2978161719 2978165066 234
516 iso_pr_bacteria 2989793055 2989797435 234
517 iso_pr_bacteria 2996406003 2996409975 234
518 iso_pr_bacteria 2996467878 2996471695 234
519 iso_pr_bacteria 3000861951 3000863488 234
520 iso_pr_bacteria 3001459110 3001460710 234
521 iso_pr_bacteria 3001462594 3001464412 234
522 iso_pr_bacteria 3004010258 3004010805 234
523 iso_pr_bacteria 3004364956 3004366824 234
524 iso_pr_bacteria 3006242587 3006245191 234
525 iso_pr_bacteria 3007994558 3007997677 234
526 iso_pr_bacteria 637000270 637852048 234
527 iso_pr_bacteria 648276708 648771362 234
528 iso_pr_bacteria 650716016 651012540 234
529 iso_pr_bacteria 651285005 651304584 234
530 iso_pr_bacteria 651324086 651696344 234
531 iso_pr_bacteria 8001059720 8001061022 234
532 iso_pr_bacteria 8004118532 8004123208 234
533 iso_pr_bacteria 8004285568 8004288384 234
534 iso_pr_bacteria 8004307473 8004310851 234
535 iso_pr_bacteria 8004541719 8004544755 234
536 iso_pr_bacteria 8004571736 8004575574 234
537 iso_pr_bacteria 8004582426 8004585208 234
538 iso_pr_bacteria 8018312681 8018315785 234
539 iso_pr_bacteria 8021535516 8021540796 234
540 iso_pr_bacteria 8021540981 8021544399 234
541 iso_pr_bacteria 8021546568 8021550380 234
542 iso_pr_bacteria 8022116796 8022119181 234
543 iso_pr_bacteria 8022345672 8022349767 234
544 iso_pr_bacteria 8028002147 8028002700 234
545 iso_pr_bacteria 8048923410 8048926743 234
546 iso_pr_bacteria 8048928574 8048931931 234
547 iso_pr_bacteria 8062647588 8062649708 234
548 iso_pr_bacteria 8065462725 8065465256 234
549 iso_pr_bacteria 8065466226 8065468283 234
550 iso_pr_bacteria 8065469765 8065471912 234
551 iso_pr_bacteria 8071322446 8071325653 234
552 iso_pr_bacteria 8071333649 8071336781 234
553 iso_pr_bacteria 8071338694 8071341843 234
554 iso_pr_bacteria 8071343737 8071346865 234
555 iso_pr_bacteria 8073124432 8073127145 234
556 iso_pr_bacteria 8074288691 8074290766 234
557 iso_pr_bacteria 8074292191 8074294329 234
558 iso_pr_bacteria 8099192374 8099196755 234
559 iso_pr_bacteria 8100171289 8100174569 234
560 iso_pr_bacteria 8100176769 8100179816 234
561 iso_pr_bacteria 8100181737 8100184905 234
562 iso_pr_bacteria 8102982778 8102986329 234
563 iso_pr_bacteria 8103002986 8103006548 234
564 iso_pr_bacteria 8103008710 8103012043 234
565 iso_pr_bacteria 8110023836 8110027226 234
566 iso_pr_bacteria 8116627632 8116630306 234
567 3300000333 HBC_ctgsDRAFT_1013439 HBC_ctgsDRAFT_10134392 235
568 3300002464 Meta3P_1002997 Meta3P_10029971 235
569 3300003973 Ga0063521_1000313 Ga0063521_10003135 235
570 3300003973 Ga0063521_1020345 Ga0063521_10203451 235
571 3300005314 Ga0074309_1001975 Ga0074309_10019755 235
572 3300005316 Ga0074302_1033331 Ga0074302_10333313 235
573 3300005318 Ga0074188_1000785 Ga0074188_100078513 235
574 3300007106 Ga0104041_1032452 Ga0104041_10324525 235
575 3300007106 Ga0104041_1124134 Ga0104041_11241341 235
576 3300007136 Ga0104044_1153011 Ga0104044_11530111 235
577 3300007149 Ga0104040_1035472 Ga0104040_10354723 235
578 3300007149 Ga0104040_1142496 Ga0104040_11424965 235
579 3300007224 Ga0104147_1031221 Ga0104147_103122113 235
580 3300007505 Ga0105005_1082509 Ga0105005_10825095 235
581 3300007767 Ga0105553_1023974 Ga0105553_10239744 235
582 3300012819 Ga0160468_100575 Ga0160468_1005755 235
583 3300012854 Ga0160448_100189 Ga0160448_1001895 235
584 3300042601 Ga0466707_070416 Ga0466707_070416_74700_75407 235
585 iso_pr_bacteria 2519899623 2520396428 235
586 iso_pr_bacteria 2531839602 2534154668 235
587 iso_pr_bacteria 2836714267 2836718160 235
588 iso_pr_bacteria 2938192669 2938197298 235
589 iso_pr_bacteria 8001394582 8001396045 235
590 3300009457 Ga0127657_111844 Ga0127657_1118445 236
591 3300042601 Ga0466707_116472 Ga0466707_116472_1725_2438 237
592 3300042582 Ga0466657_108160 Ga0466657_108160_1756_2481 241
593 3300042654 Ga0466725_025725 Ga0466725_025725_258_983 241
594 3300042649 Ga0466724_33061 Ga0466724_33061_9858_10589 243
595 3300042591 Ga0466692_165952 Ga0466692_165952_1736_2470 244
596 3300042598 Ga0466701_060431 Ga0466701_060431_814_1548 244
597 3300042598 Ga0466701_095595 Ga0466701_095595_833_1567 244
598 3300042604 Ga0466717_305513 Ga0466717_305513_590_1324 244
599 3300042611 Ga0466697_182069 Ga0466697_182069_1006_1740 244
600 3300042613 Ga0466710_016946 Ga0466710_016946_1759_2493 244
601 3300042654 Ga0466725_034927 Ga0466725_034927_16047_16781 244
602 iso_pr_bacteria 2820157249 2820158151 244
603 iso_pr_bacteria 2820161938 2820163355 244
604 iso_pr_bacteria 2820164216 2820165367 244
605 iso_pr_bacteria 2820077244 2820079228 245
606 2100351016 SWWA_contig00757__length_6462___numreads_142 SWWA_02326740 249

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 30 199 0.98

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2ov7-assembly3.cif.gz_C The first domain of the ribosomal protein L1 from Thermus thermophilus 0.914 13 198
4v9h-assembly1.cif.gz_BC Crystal structure of the ribosome bound to elongation factor G in the guanosine triphosphatase state 0.909 3 210
4v8y-assembly1.cif.gz_CL Cryo-EM reconstruction of the 80S-eIF5B-Met-itRNAMet Eukaryotic Translation Initiation Complex 0.906 3 210
5npm-assembly1.cif.gz_A CRYSTAL STRUCTURE OF MUTANT RIBOSOMAL PROTEIN TTHL1 LACKING 8 N-TERMINAL RESIDUES IN COMPLEX WITH 80NT 23S RNA FROM THERMUS THERMOPHILUS 0.905 19 210
4v5f-assembly1.cif.gz_BC The structure of the ribosome with elongation factor G trapped in the post-translocational state 0.9 4 209
IDDescriptionScoreStartEndSuperfamily
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9086 16 206 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9083 18 209 3.30.190.20
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9014 16 212 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.8872 73 159 3.40.50.790
4juxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.8675 68 159 3.40.50.790
IDDescriptionScoreStartEndGO Terms
AF-A0A6G6JUA8-F1-model_v4 Uncharacterized/unreviewed 0.9561 1 198
AF-B2VG93-F1-model_v4 Large ribosomal subunit protein uL1 0.954 1 198 GO:0022625
GO:0019843
GO:0003735
GO:0000049
GO:0006417
GO:0006412
AF-A0A502FUU0-F1-model_v4 Large ribosomal subunit protein uL1 0.9536 1 198 GO:0022625
GO:0019843
GO:0003735
GO:0000049
GO:0006417
GO:0006412
AF-A0A259Q100-F1-model_v4 Uncharacterized/unreviewed 0.953 1 176

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.