Protein Family IF00065
Metagenome
Isolate
606
Members
93
Samples
182
Scaffolds
232.83
Avg Length
Representative Sequence
- ID
- 2100351016|SWWA_contig00757__length_6462___numreads_142|SWWA_02326740
- Length
- 249 aa
- Sequence
- MAKLTKRMRVIRDKVDATKQYDITEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKAAGAELVGMDDLADQIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKQNLLRRKACTSRKLASPPPWVLALLSIRAVCLLQRTNRICDYRFDLGPRFV
Sample Types
Isolate
70.0%
Metagenome
30.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Order Distribution
Amphipoda
1.0%
Anostraca
0.2%
Araneae
0.0%
Blattodea
0.2%
Calanoida
0.0%
Coleoptera
9.6%
Copepoda
0.0%
Decapoda
5.5%
Diplopoda
0.8%
Diplostraca
0.2%
Diptera
13.2%
Euphausiacea
0.0%
Hemiptera
7.1%
Hymenoptera
28.7%
Insect (unknown)
0.0%
Isopoda
0.3%
Isoptera
17.8%
Ixodida
0.0%
Lepidoptera
0.2%
Mecoptera
0.0%
NA
0.0%
Odonata
0.0%
Orthoptera
0.2%
Phthiraptera
0.0%
Psocodea
0.0%
Sarcoptiformes
0.0%
Siphonaptera
0.0%
Spirobolida
0.0%
Thysanoptera
0.2%
Trombidiformes
0.0%
Taxonomy
Archaea
0
Bacteria
557
Eukaryota
0
Viruses
0
Unclassified
49
Samples
| # | Sample ID | Description | Type | Environment |
|---|---|---|---|---|
| 1 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Hymenoptera |
| 2 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Diptera |
| 3 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Hymenoptera |
| 4 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Diptera |
| 5 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Hymenoptera |
| 6 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Diptera |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Isoptera |
| 8 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Hemiptera |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Isoptera |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Isoptera |
| 11 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Isoptera |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Isoptera |
| 13 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Hymenoptera |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Isoptera |
| 15 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Hymenoptera |
| 16 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Hymenoptera |
| 17 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Diptera |
| 18 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | Hemiptera |
| 19 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | Hemiptera |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Isoptera |
| 21 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Isoptera |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Isoptera |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Isoptera |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Isoptera |
| 25 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | Isoptera |
| 26 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Hymenoptera |
| 27 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Hymenoptera |
| 28 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Diptera |
| 29 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Diptera |
| 30 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Diptera |
| 31 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Hymenoptera |
| 32 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | Hemiptera |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Isoptera |
| 34 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Isopoda |
| 35 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Diptera |
| 36 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | Isoptera |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Isoptera |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Isoptera |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Isoptera |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Isoptera |
| 41 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Isoptera |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Isoptera |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Isoptera |
| 44 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Coleoptera |
| 45 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Hymenoptera |
| 46 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | Decapoda |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Isoptera |
| 48 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Isoptera |
| 49 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | Diplopoda |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Isoptera |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Isoptera |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Isoptera |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Isoptera |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Isoptera |
| 55 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Hymenoptera |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Isoptera |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Isoptera |
| 58 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Isoptera |
| 59 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Isoptera |
| 60 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Coleoptera |
| 61 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Coleoptera |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Diplopoda |
| 63 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | Hemiptera |
| 64 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Hymenoptera |
| 65 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Hymenoptera |
| 66 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Diptera |
| 67 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Hymenoptera |
| 68 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 69 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Diptera |
| 70 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Isoptera |
| 71 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Isoptera |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Isoptera |
| 73 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Coleoptera |
| 74 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Hymenoptera |
| 75 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Diptera |
| 76 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Hymenoptera |
| 77 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Isopoda |
| 78 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Isoptera |
| 79 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Isoptera |
| 80 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Coleoptera |
| 81 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Hymenoptera |
| 82 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Hymenoptera |
| 83 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Isoptera |
| 84 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Hymenoptera |
| 85 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Diptera |
| 86 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Diptera |
| 87 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Hymenoptera |
| 88 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Diptera |
| 89 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Isoptera |
| 90 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Isoptera |
| 91 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Isoptera |
| 92 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Isoptera |
| 93 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Coleoptera |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 2 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 3 | gam1t_NODE_697774_length=10685_GC=35_1_Contigs=7 | 2189573031 | Bacteria | 10745 |
| 4 | SCG598O11_12230 | 3300000471 | Bacteria | 107509 |
| 5 | SCG598L16_134585 | 3300000490 | Bacteria | 40638 |
| 6 | CVPL005W_1000638 | 3300002934 | Unclassified | 12612 |
| 7 | Ga0068302_10464553 | 3300005071 | Bacteria | 2233 |
| 8 | Ga0074302_1033331 | 3300005316 | Bacteria | 3291 |
| 9 | Ga0103266_1000120 | 3300007067 | Bacteria | 38540 |
| 10 | Ga0104040_1142496 | 3300007149 | Unclassified | 2709 |
| 11 | Ga0466734_106641 | 3300042623 | Bacteria | 3060 |
| 12 | Ga0466703_293128 | 3300042636 | Bacteria | 3218 |
| 13 | Ga0466724_31876 | 3300042649 | Unclassified | 3784 |
| 14 | Ga0160468_100575 | 3300012819 | Unclassified | 13837 |
| 15 | Ga0415639_190881 | 3300038395 | Bacteria | 1848 |
| 16 | Ga0123356_10041924 | 3300010049 | Unclassified | 4265 |
| 17 | Ga0466701_095595 | 3300042598 | Bacteria | 3505 |
| 18 | Ga0466719_102463 | 3300042606 | Bacteria | 3314 |
| 19 | Ga0466726_370927 | 3300042619 | Bacteria | 1140 |
| 20 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 21 | SWWA_contig31944__length_3424___numreads_200 | 2100351016 | Bacteria | 3424 |
| 22 | Ga0068305_10306353 | 3300005083 | Unclassified | 1473 |
| 23 | Ga0074278_107915 | 3300005721 | Bacteria | 8064 |
| 24 | Ga0104049_1137921 | 3300007103 | Bacteria | 992 |
| 25 | Ga0104041_1032452 | 3300007106 | Bacteria | 11314 |
| 26 | Ga0104019_1189993 | 3300007150 | Bacteria | 3024 |
| 27 | Ga0105005_1082509 | 3300007505 | Unclassified | 7768 |
| 28 | Ga0105005_1278873 | 3300007505 | Bacteria | 2299 |
| 29 | Ga0105524_102375 | 3300007733 | Bacteria | 5956 |
| 30 | Ga0127524_178098 | 3300009478 | Bacteria | 1164 |
| 31 | Ga0466735_122292 | 3300042624 | Bacteria | 2396 |
| 32 | Ga0466730_031310 | 3300042625 | Bacteria | 150332 |
| 33 | Ga0466703_259944 | 3300042636 | Bacteria | 27101 |
| 34 | Ga0466724_36307 | 3300042649 | Bacteria | 158990 |
| 35 | Ga0466708_010991 | 3300042652 | Bacteria | 11017 |
| 36 | Ga0466725_020645 | 3300042654 | Unclassified | 1428 |
| 37 | Ga0160441_111273 | 3300012825 | Unclassified | 1052 |
| 38 | Ga0466657_108160 | 3300042582 | Bacteria | 16433 |
| 39 | Ga0466690_019836 | 3300042590 | Bacteria | 6253 |
| 40 | Ga0123356_10064162 | 3300010049 | Bacteria | 3433 |
| 41 | Ga0466706_029080 | 3300042599 | Bacteria | 3413 |
| 42 | Ga0466713_053525 | 3300042602 | Unclassified | 3289 |
| 43 | Ga0466719_486193 | 3300042606 | Bacteria | 1498 |
| 44 | Ga0466722_129668 | 3300042609 | Bacteria | 5075 |
| 45 | Ga0466710_094963 | 3300042613 | Bacteria | 1848 |
| 46 | Ga0466710_174796 | 3300042613 | Bacteria | 5110 |
| 47 | Ga0466715_168909 | 3300042616 | Bacteria | 2268 |
| 48 | Ga0466715_188360 | 3300042616 | Bacteria | 4144 |
| 49 | Ga0466726_197069 | 3300042619 | Bacteria | 12655 |
| 50 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 51 | FGTW_contig30737 | 2065487013 | Unclassified | 10134 |
| 52 | gam1t_NODE_593770_length=43570_GC=36_1_Contigs=1 | 2189573031 | Bacteria | 43570 |
| 53 | 2227302991 | 2225789004 | Bacteria | 30056 |
| 54 | HBC_ctgsDRAFT_1000273 | 3300000333 | Bacteria | 11948 |
| 55 | Ga0074302_1031568 | 3300005316 | Unclassified | 906 |
| 56 | Ga0103265_1002939 | 3300007068 | Unclassified | 2577 |
| 57 | Ga0102735_1000021 | 3300007080 | Bacteria | 54507 |
| 58 | Ga0102740_1003849 | 3300007140 | Unclassified | 3099 |
| 59 | Ga0103267_1000596 | 3300007190 | Unclassified | 10548 |
| 60 | Ga0103268_1000203 | 3300007192 | Bacteria | 32563 |
| 61 | Ga0466705_353242 | 3300042612 | Bacteria | 39923 |
| 62 | Ga0466734_059648 | 3300042623 | Bacteria | 14587 |
| 63 | Ga0466704_068158 | 3300042643 | Bacteria | 8115 |
| 64 | Ga0466724_33061 | 3300042649 | Bacteria | 10924 |
| 65 | Ga0466725_034927 | 3300042654 | Bacteria | 18676 |
| 66 | Ga0466727_245442 | 3300042655 | Bacteria | 20970 |
| 67 | Ga0316159_10002 | 3300030930 | Bacteria | 247683 |
| 68 | Ga0123355_10416996 | 3300009826 | Bacteria | 1719 |
| 69 | Ga0466701_044424 | 3300042598 | Bacteria | 22119 |
| 70 | Ga0466710_016946 | 3300042613 | Bacteria | 6618 |
| 71 | Ga0466711_023181 | 3300042615 | Bacteria | 3320 |
| 72 | Ga0466711_177147 | 3300042615 | Bacteria | 7473 |
| 73 | Ga0466711_424242 | 3300042615 | Bacteria | 4850 |
| 74 | Ga0466728_117967 | 3300042620 | Bacteria | 18009 |
| 75 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 76 | SPBB_contig11649 | 2044078006 | Unclassified | 6774 |
| 77 | gam1t_NODE_392340_length=7081_GC=35_6_Contigs=2 | 2189573031 | Unclassified | 7091 |
| 78 | HBC_ctgsDRAFT_1015445 | 3300000333 | Unclassified | 1850 |
| 79 | WW0001_100081 | 3300002732 | Bacteria | 214513 |
| 80 | Ga0063521_1000313 | 3300003973 | Bacteria | 29434 |
| 81 | Ga0104041_1124134 | 3300007106 | Unclassified | 903 |
| 82 | Ga0466705_352026 | 3300042612 | Bacteria | 6215 |
| 83 | Ga0466704_591825 | 3300042643 | Unclassified | 4044 |
| 84 | Ga0466724_12131 | 3300042649 | Unclassified | 3029 |
| 85 | Ga0160441_111256 | 3300012825 | Unclassified | 1053 |
| 86 | Ga0160433_101543 | 3300012846 | Unclassified | 6148 |
| 87 | Ga0466657_375608 | 3300042582 | Bacteria | 3714 |
| 88 | Ga0123356_10360445 | 3300010049 | Bacteria | 1581 |
| 89 | Ga0466719_359350 | 3300042606 | Bacteria | 1615 |
| 90 | Ga0466715_356726 | 3300042616 | Bacteria | 3722 |
| 91 | Ga0466733_021577 | 3300042659 | Bacteria | 12342 |
| 92 | SWWA_contig00757__length_6462___numreads_142 | 2100351016 | Bacteria | 6462 |
| 93 | HBC_ctgsDRAFT_1013439 | 3300000333 | Unclassified | 1971 |
| 94 | SCG598I20_11809 | 3300000473 | Unclassified | 10125 |
| 95 | Ga0063521_1020345 | 3300003973 | Unclassified | 1599 |
| 96 | Ga0102734_1003151 | 3300007129 | Bacteria | 7255 |
| 97 | Ga0104050_1003526 | 3300007153 | Bacteria | 2506 |
| 98 | Ga0103267_1008156 | 3300007190 | Bacteria | 3085 |
| 99 | Ga0466697_182069 | 3300042611 | Bacteria | 3157 |
| 100 | Ga0466730_008492 | 3300042625 | Bacteria | 6038 |
| 101 | Ga0466730_067021 | 3300042625 | Unclassified | 5696 |
| 102 | Ga0160448_128272 | 3300012854 | Unclassified | 833 |
| 103 | Ga0160435_1003941 | 3300012857 | Unclassified | 3472 |
| 104 | Ga0466657_312701 | 3300042582 | Bacteria | 2610 |
| 105 | Ga0466690_273225 | 3300042590 | Bacteria | 5414 |
| 106 | Ga0466701_041583 | 3300042598 | Bacteria | 9889 |
| 107 | Ga0466701_060431 | 3300042598 | Bacteria | 3329 |
| 108 | Ga0466707_032892 | 3300042601 | Bacteria | 15973 |
| 109 | Ga0466717_305513 | 3300042604 | Bacteria | 1446 |
| 110 | Ga0466719_025208 | 3300042606 | Bacteria | 11206 |
| 111 | Ga0466719_291670 | 3300042606 | Bacteria | 7280 |
| 112 | Ga0466726_132207 | 3300042619 | Bacteria | 4741 |
| 113 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 114 | SPBB_contig11642 | 2044078006 | Unclassified | 8416 |
| 115 | FGTW_contig30635 | 2065487013 | Unclassified | 13028 |
| 116 | SCG598B02_11437 | 3300000472 | Bacteria | 26544 |
| 117 | Meta3P_1002997 | 3300002464 | Unclassified | 1182 |
| 118 | Ga0104044_1153011 | 3300007136 | Unclassified | 890 |
| 119 | Ga0103267_1007438 | 3300007190 | Bacteria | 3187 |
| 120 | Ga0466730_027359 | 3300042625 | Bacteria | 2139 |
| 121 | Ga0466704_254314 | 3300042643 | Bacteria | 1281 |
| 122 | Ga0466709_215386 | 3300042648 | Bacteria | 5842 |
| 123 | Ga0466724_58247 | 3300042649 | Unclassified | 13637 |
| 124 | Ga0466708_090892 | 3300042652 | Bacteria | 12888 |
| 125 | Ga0466725_087349 | 3300042654 | Bacteria | 25586 |
| 126 | Ga0265387_1000220 | 3300024582 | Unclassified | 9816 |
| 127 | Ga0466657_019139 | 3300042582 | Bacteria | 2649 |
| 128 | Ga0466692_099727 | 3300042591 | Bacteria | 7911 |
| 129 | Ga0123357_10007607 | 3300009784 | Bacteria | 13417 |
| 130 | Ga0123353_10006445 | 3300010167 | Unclassified | 15620 |
| 131 | Ga0466701_051034 | 3300042598 | Bacteria | 2764 |
| 132 | Ga0466707_116472 | 3300042601 | Bacteria | 15218 |
| 133 | Ga0466707_215871 | 3300042601 | Bacteria | 2831 |
| 134 | Ga0466719_337375 | 3300042606 | Bacteria | 15916 |
| 135 | Ga0466726_336815 | 3300042619 | Bacteria | 12910 |
| 136 | Ga0466729_053965 | 3300042621 | Bacteria | 4381 |
| 137 | Ga0063521_1001404 | 3300003973 | Bacteria | 6676 |
| 138 | Ga0074309_1001975 | 3300005314 | Unclassified | 2858 |
| 139 | Ga0074188_1000785 | 3300005318 | Bacteria | 8554 |
| 140 | Ga0102733_101184 | 3300006995 | Unclassified | 1594 |
| 141 | Ga0102737_1002752 | 3300007142 | Bacteria | 4229 |
| 142 | Ga0103264_1018676 | 3300007188 | Unclassified | 3383 |
| 143 | Ga0104147_1031221 | 3300007224 | Bacteria | 10290 |
| 144 | Ga0105553_1023974 | 3300007767 | Unclassified | 14819 |
| 145 | Ga0127657_104882 | 3300009457 | Bacteria | 32634 |
| 146 | Ga0466730_040928 | 3300042625 | Bacteria | 3887 |
| 147 | Ga0466724_05511 | 3300042649 | Unclassified | 2789 |
| 148 | Ga0466708_074047 | 3300042652 | Bacteria | 28825 |
| 149 | Ga0466708_407205 | 3300042652 | Bacteria | 13399 |
| 150 | Ga0466725_025725 | 3300042654 | Bacteria | 1527 |
| 151 | Ga0160448_100189 | 3300012854 | Unclassified | 25936 |
| 152 | Ga0466690_427016 | 3300042590 | Bacteria | 17189 |
| 153 | Ga0466691_125132 | 3300042593 | Bacteria | 17265 |
| 154 | Ga0136159_1000066 | 3300010217 | Bacteria | 97058 |
| 155 | Ga0466713_073082 | 3300042602 | Bacteria | 8444 |
| 156 | Ga0466713_114375 | 3300042602 | Unclassified | 3282 |
| 157 | Ga0466719_101988 | 3300042606 | Unclassified | 3494 |
| 158 | Ga0466723_113112 | 3300042618 | Bacteria | 15978 |
| 159 | Ga0466729_196921 | 3300042621 | Bacteria | 13939 |
| 160 | Ga0562378_0022 | 3300056814 | Bacteria | 672696 |
| 161 | HBC_ctgsDRAFT_1028386 | 3300000333 | Unclassified | 1374 |
| 162 | Ga0063521_1000120 | 3300003973 | Bacteria | 59713 |
| 163 | Ga0102734_1000416 | 3300007129 | Bacteria | 12184 |
| 164 | Ga0104040_1035472 | 3300007149 | Bacteria | 3075 |
| 165 | Ga0103267_1000404 | 3300007190 | Bacteria | 14060 |
| 166 | Ga0105005_1082772 | 3300007505 | Unclassified | 2158 |
| 167 | Ga0127656_100105 | 3300009453 | Bacteria | 45606 |
| 168 | Ga0127657_111844 | 3300009457 | Bacteria | 5841 |
| 169 | Ga0466704_324912 | 3300042643 | Unclassified | 1161 |
| 170 | Ga0466727_026338 | 3300042655 | Bacteria | 2674 |
| 171 | Ga0466690_415645 | 3300042590 | Bacteria | 1725 |
| 172 | Ga0466692_047041 | 3300042591 | Bacteria | 13657 |
| 173 | Ga0466692_165952 | 3300042591 | Bacteria | 3488 |
| 174 | Ga0466701_005002 | 3300042598 | Bacteria | 6930 |
| 175 | Ga0123355_10118758 | 3300009826 | Bacteria | 4108 |
| 176 | Ga0466701_054507 | 3300042598 | Unclassified | 2769 |
| 177 | Ga0466707_059026 | 3300042601 | Unclassified | 5649 |
| 178 | Ga0466707_070416 | 3300042601 | Bacteria | 77540 |
| 179 | Ga0466714_012163 | 3300042603 | Bacteria | 1783 |
| 180 | Ga0466719_167285 | 3300042606 | Bacteria | 7182 |
| 181 | Ga0466712_153020 | 3300042614 | Bacteria | 5647 |
| 182 | Ga0466723_178420 | 3300042618 | Bacteria | 5459 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00687 | Ribosomal_L1 | Ribosomal protein L1p/L10e family | 30 | 199 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.