Protein Family IF00042

Metagenome Isolate
264 Members
66 Samples
119 Scaffolds
400.87 Avg Length

🧬 Representative Sequence

ID
2044078006|SPBB_contig11524|SPBB_334520
Length
449 aa
Sequence
MRIIGAVALAHLINDLIQAVLPSIYPMLKQSYGLTFTQVGLITLAFQLTASLLQPWVGYYTDRHPKPYLLPMGMICTLIGILMMSQVGSFPLILLASALIGIGSSTFHPEASRVARLASGGRFGLAQSTFQVGGNAGTAFGPLLAAAIIIPYGQGNVAWFGLFAVFALVVLYAISRWYANHLRLFKLKQGQAATHGLSKARVLSALVVLGLLVFSKYFYMSSFTSYFTFYLIEKFDLSVASSQLHLFLFLGAVAAGTFFGGPIGDRIGRKAVIWFSILGVAPFTLILPHVDLFWTSVLSVVIGFILASAFSAIVVYAQELVPGNVGMIAGVFFGLMFGFGGIGAALLGYVADAHGIEYVYRLCAYLPLFGILAIFLPRSKKPDRPRACPRSVSCVADRSRVTQLPPLSSNRPASAGRKRCRALYEKGFRFFLFLNDIHLHYNRAFLSAP

📊 Sample Types

Isolate 54.9%
Metagenome 45.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🦗 Order Distribution

Amphipoda 0.0%
Anostraca 0.0%
Araneae 0.0%
Blattodea 0.4%
Calanoida 0.0%
Coleoptera 15.9%
Copepoda 0.0%
Decapoda 0.8%
Diplopoda 6.1%
Diplostraca 0.0%
Diptera 14.8%
Euphausiacea 0.0%
Hemiptera 6.1%
Hymenoptera 17.8%
Insect (unknown) 0.0%
Isopoda 3.0%
Isoptera 22.4%
Ixodida 0.0%
Lepidoptera 0.4%
Mecoptera 0.0%
NA 0.0%
Odonata 0.0%
Orthoptera 0.0%
Phthiraptera 0.0%
Psocodea 0.0%
Sarcoptiformes 0.0%
Siphonaptera 0.4%
Spirobolida 0.0%
Thysanoptera 0.0%
Trombidiformes 0.0%

🌳 Taxonomy

Archaea 0
Bacteria 249
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeEnvironment
1 3300000479 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 Metagenome Hymenoptera
2 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Coleoptera
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Isoptera
4 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome Diplopoda
5 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome Diplopoda
6 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Isopoda
7 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Lepidoptera
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Isoptera
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Isoptera
10 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Isoptera
11 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome Isoptera
12 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Hymenoptera
13 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Diptera
14 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Isopoda
15 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome Diplopoda
16 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Diptera
17 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Diptera
18 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Diptera
19 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome Isoptera
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Isoptera
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Isoptera
22 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Isoptera
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Isoptera
24 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Diplopoda
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Isoptera
26 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Diptera
27 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
28 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome Diplopoda
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Isoptera
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Isoptera
31 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Coleoptera
32 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Hymenoptera
33 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Diptera
34 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Diptera
35 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Isopoda
36 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Diptera
37 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Isoptera
38 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Coleoptera
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Diplopoda
40 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Diptera
41 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Diptera
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Isoptera
43 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome Diplopoda
44 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Isopoda
45 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Diptera
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Isoptera
47 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Isoptera
48 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Isopoda
49 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Diptera
50 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Diptera
51 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Isoptera
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Isoptera
53 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Coleoptera
54 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Coleoptera
55 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome Diplopoda
56 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Isopoda
57 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Diptera
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Isoptera
59 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Coleoptera
60 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Hymenoptera
61 3300000475 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 Metagenome Hymenoptera
62 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Hymenoptera
63 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Diptera
64 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome Diplopoda
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Isoptera
66 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Isoptera

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160468_100256 3300012819 Bacteria 28144
2 Ga0160434_100510 3300012850 Bacteria 10217
3 Ga0160430_106571 3300012852 Bacteria 2460
4 Ga0160436_1000547 3300012861 Bacteria 13800
5 IMNBL1DRAFT_c0001827 3300000062 Bacteria 15502
6 SCG598P14_112701 3300000479 Bacteria 35504
7 Ga0466701_036438 3300042598 Bacteria 169982
8 Ga0466707_014260 3300042601 Bacteria 17940
9 Ga0466713_014081 3300042602 Bacteria 234884
10 Ga0466719_561542 3300042606 Bacteria 2448
11 Ga0466724_03330 3300042649 Bacteria 44563
12 Ga0466724_05777 3300042649 Unclassified 50607
13 Ga0466724_68222 3300042649 Unclassified 21408
14 Ga0160472_101074 3300012839 Bacteria 9449
15 Ga0160443_100167 3300012848 Bacteria 91984
16 Ga0160447_100415 3300012849 Bacteria 21005
17 Ga0160436_1000567 3300012861 Bacteria 13466
18 Ga0466692_003819 3300042591 Bacteria 6401
19 Ga0466696_059542 3300042596 Bacteria 6598
20 DPO_contig06369 2032320009 Unclassified 6563
21 Ga0104041_1030476 3300007106 Bacteria 5327
22 Ga0466701_055000 3300042598 Bacteria 242806
23 Ga0466713_050958 3300042602 Bacteria 35586
24 Ga0466705_358543 3300042612 Bacteria 7634
25 Ga0466704_230523 3300042643 Bacteria 1484
26 Ga0466724_47936 3300042649 Bacteria 19059
27 Ga0466724_60368 3300042649 Bacteria 50984
28 Ga0466708_094676 3300042652 Bacteria 157715
29 Ga0160458_100074 3300012832 Bacteria 123747
30 Ga0160472_100574 3300012839 Unclassified 21341
31 Ga0160430_100002 3300012852 Bacteria 510179
32 Ga0160436_1006530 3300012861 Unclassified 2695
33 Ga0247289_0300 3300035363 Unclassified 8775
34 SPBB_contig00360 2044078006 Bacteria 40893
35 FGTW_contig30555 2065487013 Bacteria 12633
36 2227614355 2225789004 Bacteria 2237
37 IMNBL1DRAFT_c0002597 3300000062 Bacteria 12416
38 JGI24702J35022_10017697 3300002462 Bacteria 3891
39 Ga0104049_1131284 3300007103 Bacteria 2870
40 Ga0160454_100224 3300012798 Bacteria 57381
41 Ga0466711_044119 3300042615 Bacteria 2950
42 Ga0466730_009057 3300042625 Bacteria 8760
43 Ga0466704_075067 3300042643 Bacteria 20540
44 Ga0466724_06065 3300042649 Bacteria 94573
45 Ga0160431_100262 3300012828 Bacteria 33659
46 Ga0160433_100155 3300012846 Bacteria 58519
47 Ga0466691_079274 3300042593 Bacteria 5036
48 2227080769 2225789004 Bacteria 257506
49 2227530177 2225789004 Bacteria 16424
50 SCG598J21_12951 3300000475 Bacteria 44371
51 CVPL010L_1001188 3300002932 Unclassified 5759
52 Ga0123357_10030840 3300009784 Bacteria 7273
53 Ga0466707_269881 3300042601 Bacteria 1558
54 Ga0466730_001041 3300042625 Bacteria 1802
55 Ga0466730_007214 3300042625 Bacteria 2834
56 Ga0466730_013284 3300042625 Bacteria 61349
57 Ga0466730_087551 3300042625 Bacteria 89610
58 Ga0466724_60162 3300042649 Bacteria 60503
59 Ga0160469_100258 3300012824 Unclassified 39532
60 Ga0160443_102165 3300012848 Bacteria 4745
61 Ga0160443_104787 3300012848 Bacteria 1963
62 Ga0466696_285572 3300042596 Bacteria 5366
63 Ga0562379_0001 3300056790 Bacteria 4904077
64 Ga0562377_0002 3300056842 Bacteria 4351833
65 Ga0562376_0001 3300056857 Bacteria 4828905
66 DPO_contig06785 2032320009 Bacteria 13966
67 IMNBL1DRAFT_c0011878 3300000062 Bacteria 4028
68 Ga0160465_100240 3300012803 Bacteria 40681
69 Ga0160465_100382 3300012803 Unclassified 24074
70 Ga0160466_100384 3300012809 Bacteria 25001
71 Ga0466722_140100 3300042609 Bacteria 12281
72 Ga0466705_061189 3300042612 Bacteria 19164
73 Ga0160445_100004 3300012847 Bacteria 501773
74 Ga0265387_1000108 3300024582 Bacteria 19205
75 Ga0562377_0001 3300056842 Bacteria 5082480
76 Ga0105005_1032384 3300007505 Bacteria 8519
77 Ga0123357_10134869 3300009784 Bacteria 3057
78 Ga0466726_429877 3300042619 Bacteria 26082
79 Ga0466713_148277 3300042602 Bacteria 181035
80 Ga0160432_100496 3300012818 Bacteria 24900
81 Ga0160435_1000142 3300012857 Bacteria 40334
82 Ga0466696_215115 3300042596 Bacteria 1580
83 SPBB_contig11524 2044078006 Bacteria 77152
84 SWWA_contig31857__length_4576___numreads_238 2100351016 Unclassified 4576
85 2227247477 2225789004 Unclassified 7161
86 HBC_ctgsDRAFT_1008214 3300000333 Bacteria 2471
87 Meta3P_1000705 3300002464 Unclassified 11343
88 Ga0063521_1000082 3300003973 Bacteria 78761
89 Ga0074278_109326 3300005721 Bacteria 18720
90 Ga0104042_1035014 3300007130 Bacteria 3467
91 Ga0104050_1001141 3300007153 Bacteria 13085
92 Ga0123357_10008532 3300009784 Bacteria 12816
93 Ga0123354_10004897 3300010882 Bacteria 19199
94 Ga0466701_031174 3300042598 Bacteria 92921
95 Ga0466707_022169 3300042601 Bacteria 38620
96 Ga0466707_233833 3300042601 Bacteria 1571
97 Ga0466730_029041 3300042625 Bacteria 10891
98 Ga0466724_51867 3300042649 Unclassified 19042
99 Ga0160453_100016 3300012814 Bacteria 266659
100 Ga0160467_102188 3300012829 Bacteria 4812
101 Ga0160446_101339 3300012835 Bacteria 5470
102 Ga0160460_101203 3300012845 Bacteria 9714
103 Ga0160435_1000298 3300012857 Bacteria 21126
104 HBC_ctgsDRAFT_1013222 3300000333 Unclassified 1986
105 Meta3P_1000236 3300002464 Bacteria 24894
106 Ga0104040_1039457 3300007149 Bacteria 5340
107 Ga0104147_1027984 3300007224 Bacteria 12805
108 Ga0123357_10024752 3300009784 Bacteria 8090
109 Ga0466705_448479 3300042612 Bacteria 2185
110 Ga0466701_019405 3300042598 Bacteria 47076
111 Ga0466707_064926 3300042601 Bacteria 3850
112 Ga0466735_143378 3300042624 Bacteria 3964
113 Ga0466735_170596 3300042624 Bacteria 3429
114 Ga0466730_019112 3300042625 Unclassified 4349
115 Ga0466730_053692 3300042625 Bacteria 19216
116 Ga0466724_23693 3300042649 Bacteria 54133
117 Ga0466724_54961 3300042649 Bacteria 72912
118 Ga0466724_64498 3300042649 Bacteria 13151
119 Ga0466727_118354 3300042655 Bacteria 4444

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_285572 Ga0466696_285572_1378_2505 357
2 3300012848 Ga0160443_104787 Ga0160443_1047872 360
3 3300012848 Ga0160443_100167 Ga0160443_10016771 361
4 2225789004 2227614355 2228188269 369
5 3300042643 Ga0466704_075067 Ga0466704_075067_1438_2658 374
6 3300000062 IMNBL1DRAFT_c0011878 IMNBL1DRAFT_00118783 375
7 3300002932 CVPL010L_1001188 CVPL010L_10011883 376
8 3300012824 Ga0160469_100258 Ga0160469_1002582 376
9 3300042649 Ga0466724_64498 Ga0466724_64498_5909_7129 376
10 2225789004 2227530177 2228041550 377
11 3300002464 Meta3P_1000705 Meta3P_10007056 377
12 3300012819 Ga0160468_100256 Ga0160468_1002562 377
13 3300042596 Ga0466696_215115 Ga0466696_215115_298_1488 377
14 3300042615 Ga0466711_044119 Ga0466711_044119_146_1357 378
15 3300002464 Meta3P_1000236 Meta3P_10002367 379
16 3300010882 Ga0123354_10004897 Ga0123354_1000489716 379
17 iso_pr_bacteria 2585428136 2588037184 380
18 iso_pr_bacteria 2857835046 2857836971 380
19 iso_pr_bacteria 8119099601 8119100281 380
20 3300042601 Ga0466707_269881 Ga0466707_269881_95_1270 381
21 iso_pr_bacteria 2864751016 2864752563 381
22 2032320009 DPO_contig06369 DPOB_354810 382
23 2032320009 DPO_contig06785 DPOB_173050 382
24 2044078006 SPBB_contig00360 SPBB_149810 382
25 2100351016 SWWA_contig31857__length_4576___numreads_238 SWWA_02682570 382
26 3300042598 Ga0466701_019405 Ga0466701_019405_31444_32592 382
27 3300042625 Ga0466730_053692 Ga0466730_053692_6113_7315 382
28 3300012809 Ga0160466_100384 Ga0160466_10038422 383
29 iso_pr_bacteria 2864755708 2864760731 384
30 2225789004 2227247477 2227689569 385
31 3300012839 Ga0160472_100574 Ga0160472_1005742 385
32 3300012861 Ga0160436_1006530 Ga0160436_10065302 385
33 3300042612 Ga0466705_358543 Ga0466705_358543_6183_7403 385
34 2225789004 2227080769 2227450444 387
35 3300042612 Ga0466705_448479 Ga0466705_448479_855_2057 388
36 3300056857 Ga0562376_0001 Ga0562376_0001_1207235_1208455 388
37 3300000333 HBC_ctgsDRAFT_1008214 HBC_ctgsDRAFT_10082142 389
38 3300005721 Ga0074278_109326 Ga0074278_10932621 389
39 3300009784 Ga0123357_10024752 Ga0123357_100247528 390
40 3300042624 Ga0466735_170596 Ga0466735_170596_1064_2287 390
41 3300042649 Ga0466724_51867 Ga0466724_51867_2622_3818 390
42 3300009784 Ga0123357_10008532 Ga0123357_100085323 391
43 3300012829 Ga0160467_102188 Ga0160467_1021883 391
44 3300042596 Ga0466696_059542 Ga0466696_059542_3736_4968 391
45 3300042598 Ga0466701_055000 Ga0466701_055000_453_1652 391
46 3300042609 Ga0466722_140100 Ga0466722_140100_2684_3862 392
47 3300000062 IMNBL1DRAFT_c0002597 IMNBL1DRAFT_00025974 393
48 3300042591 Ga0466692_003819 Ga0466692_003819_5092_6273 393
49 3300012852 Ga0160430_106571 Ga0160430_1065713 394
50 3300042624 Ga0466735_143378 Ga0466735_143378_1061_2245 394
51 3300009784 Ga0123357_10134869 Ga0123357_101348693 395
52 3300012818 Ga0160432_100496 Ga0160432_10049620 395
53 3300012857 Ga0160435_1000142 Ga0160435_100014229 395
54 3300042601 Ga0466707_014260 Ga0466707_014260_9504_10691 395
55 3300042619 Ga0466726_429877 Ga0466726_429877_4067_5254 395
56 3300042625 Ga0466730_029041 Ga0466730_029041_1547_2767 395
57 3300042649 Ga0466724_68222 Ga0466724_68222_15527_16747 395
58 3300042606 Ga0466719_561542 Ga0466719_561542_1104_2294 396
59 3300042612 Ga0466705_061189 Ga0466705_061189_13115_14305 396
60 3300042652 Ga0466708_094676 Ga0466708_094676_123393_124583 396
61 3300012839 Ga0160472_101074 Ga0160472_1010745 397
62 3300012845 Ga0160460_101203 Ga0160460_1012035 397
63 3300012852 Ga0160430_100002 Ga0160430_100002290 397
64 3300012814 Ga0160453_100016 Ga0160453_100016149 398
65 3300012847 Ga0160445_100004 Ga0160445_100004182 398
66 3300035363 Ga0247289_0300 Ga0247289_0300_2726_3946 398
67 3300042602 Ga0466713_148277 Ga0466713_148277_167536_168756 398
68 3300042625 Ga0466730_007214 Ga0466730_007214_889_2109 398
69 3300042625 Ga0466730_013284 Ga0466730_013284_52063_53283 398
70 3300042625 Ga0466730_019112 Ga0466730_019112_2477_3697 398
71 iso_pr_bacteria 2938192669 2938196461 398
72 3300012848 Ga0160443_102165 Ga0160443_1021652 399
73 3300024582 Ga0265387_1000108 Ga0265387_10001085 399
74 3300042602 Ga0466713_050958 Ga0466713_050958_1243_2442 399
75 3300042649 Ga0466724_47936 Ga0466724_47936_2619_3818 399
76 iso_pr_bacteria 2684622927 2686106081 399
77 iso_pr_bacteria 2811994808 2812042491 399
78 iso_pr_bacteria 2834412944 2834414501 399
79 iso_pr_bacteria 2840748007 2840748337 399
80 iso_pr_bacteria 2846359427 2846359579 399
81 iso_pr_bacteria 2846361553 2846363580 399
82 iso_pr_bacteria 2846363972 2846366008 399
83 iso_pr_bacteria 2846368606 2846370050 399
84 iso_pr_bacteria 2846379220 2846380568 399
85 iso_pr_bacteria 2849402121 2849403706 399
86 iso_pr_bacteria 2849404451 2849404593 399
87 iso_pr_bacteria 2849406737 2849407081 399
88 iso_pr_bacteria 2849409164 2849409690 399
89 iso_pr_bacteria 2849411303 2849413352 399
90 iso_pr_bacteria 2849415715 2849416573 399
91 iso_pr_bacteria 2852205774 2852205957 399
92 iso_pr_bacteria 2854086477 2854088764 399
93 iso_pr_bacteria 2854088767 2854091106 399
94 iso_pr_bacteria 2854091108 2854093049 399
95 iso_pr_bacteria 2854097802 2854099901 399
96 iso_pr_bacteria 2854100132 2854101686 399
97 iso_pr_bacteria 2857825141 2857826321 399
98 iso_pr_bacteria 2857830159 2857832411 399
99 iso_pr_bacteria 2857840086 2857842407 399
100 iso_pr_bacteria 8101255641 8101255968 399
101 iso_pr_bacteria 8101258116 8101258362 399
102 iso_pr_bacteria 8101260589 8101261444 399
103 iso_pr_bacteria 8101263066 8101265105 399
104 iso_pr_bacteria 8101270055 8101271956 399
105 iso_pr_bacteria 8101272231 8101274261 399
106 iso_pr_bacteria 8101274435 8101276475 399
107 iso_pr_bacteria 8101276651 8101278573 399
108 3300000333 HBC_ctgsDRAFT_1013222 HBC_ctgsDRAFT_10132221 400
109 3300000475 SCG598J21_12951 SCG598J21_129511 400
110 3300042649 Ga0466724_06065 Ga0466724_06065_35953_37185 400
111 3300042649 Ga0466724_23693 Ga0466724_23693_5584_6816 400
112 iso_pr_bacteria 8018312681 8018315237 400
113 iso_pr_bacteria 8099192374 8099195758 400
114 2065487013 FGTW_contig30555 FGTW_01490980 401
115 3300000062 IMNBL1DRAFT_c0001827 IMNBL1DRAFT_00018274 401
116 3300002462 JGI24702J35022_10017697 JGI24702J35022_100176972 401
117 3300042601 Ga0466707_022169 Ga0466707_022169_460_1680 401
118 3300042649 Ga0466724_60162 Ga0466724_60162_46294_47529 401
119 iso_pr_bacteria 2997878596 2997879261 401
120 3300012828 Ga0160431_100262 Ga0160431_10026213 402
121 3300012849 Ga0160447_100415 Ga0160447_10041516 402
122 3300012857 Ga0160435_1000298 Ga0160435_10002984 402
123 3300042598 Ga0466701_036438 Ga0466701_036438_142262_143530 402
124 3300042601 Ga0466707_064926 Ga0466707_064926_218_1426 402
125 3300042601 Ga0466707_233833 Ga0466707_233833_122_1330 402
126 3300042643 Ga0466704_230523 Ga0466704_230523_254_1462 402
127 iso_pr_bacteria 2833053935 2833055797 402
128 iso_pr_bacteria 2864739902 2864740590 402
129 3300003973 Ga0063521_1000082 Ga0063521_100008226 403
130 3300042649 Ga0466724_05777 Ga0466724_05777_14628_15839 403
131 iso_pr_bacteria 2837516909 2837517682 403
132 iso_pr_bacteria 2846386538 2846387741 403
133 iso_pr_bacteria 2864745180 2864745798 403
134 iso_pr_bacteria 2864853652 2864857647 403
135 3300012803 Ga0160465_100240 Ga0160465_1002405 404
136 3300012803 Ga0160465_100382 Ga0160465_1003827 404
137 3300042598 Ga0466701_031174 Ga0466701_031174_33538_34752 404
138 3300042625 Ga0466730_009057 Ga0466730_009057_1177_2391 404
139 3300042649 Ga0466724_03330 Ga0466724_03330_28715_29929 404
140 3300042649 Ga0466724_60368 Ga0466724_60368_30576_31790 404
141 3300056790 Ga0562379_0001 Ga0562379_0001_4021103_4022317 404
142 3300056842 Ga0562377_0001 Ga0562377_0001_2580678_2581892 404
143 3300056842 Ga0562377_0002 Ga0562377_0002_2626329_2627543 404
144 iso_pr_bacteria 2529292851 2530232667 404
145 iso_pr_bacteria 2838140227 2838143692 404
146 iso_pr_bacteria 2841260384 2841260518 404
147 iso_pr_bacteria 2864926767 2864932013 404
148 iso_pr_bacteria 2971189173 2971193237 404
149 iso_pr_bacteria 3004010258 3004013322 404
150 iso_pr_bacteria 3007478678 3007480979 404
151 iso_pr_bacteria 637000219 637999935 404
152 iso_pr_bacteria 8006199443 8006199635 404
153 iso_pr_bacteria 8011329375 8011330223 404
154 iso_pr_bacteria 8035422605 8035424776 404
155 iso_pr_bacteria 8052469819 8052474214 404
156 iso_pr_bacteria 2519899622 2520386584 405
157 iso_pr_bacteria 2519899623 2520396504 405
158 iso_pr_bacteria 2835335304 2835339839 405
159 iso_pr_bacteria 2847708326 2847709251 405
160 iso_pr_bacteria 2864847319 2864851352 405
161 iso_pr_bacteria 2990166910 2990172106 405
162 iso_pr_bacteria 8001059720 8001060466 405
163 iso_pr_bacteria 8035321120 8035322184 405
164 iso_pr_bacteria 8035326735 8035327768 405
165 3300007103 Ga0104049_1131284 Ga0104049_11312843 406
166 3300007106 Ga0104041_1030476 Ga0104041_10304764 406
167 3300007130 Ga0104042_1035014 Ga0104042_10350143 406
168 3300007149 Ga0104040_1039457 Ga0104040_10394573 406
169 3300007505 Ga0105005_1032384 Ga0105005_10323841 406
170 3300042602 Ga0466713_014081 Ga0466713_014081_184919_186139 406
171 3300042625 Ga0466730_001041 Ga0466730_001041_309_1529 406
172 3300042625 Ga0466730_087551 Ga0466730_087551_72789_74009 406
173 3300042649 Ga0466724_54961 Ga0466724_54961_56157_57377 406
174 iso_pr_bacteria 2507262057 2507518040 406
175 iso_pr_bacteria 2537561600 2537924885 406
176 iso_pr_bacteria 2547132185 2547710498 406
177 iso_pr_bacteria 2551306516 2553377659 406
178 iso_pr_bacteria 2551306531 2553450162 406
179 iso_pr_bacteria 2588253732 2588528090 406
180 iso_pr_bacteria 2588253791 2588728934 406
181 iso_pr_bacteria 2703719239 2706049570 406
182 iso_pr_bacteria 2703719240 2706054848 406
183 iso_pr_bacteria 2718217944 2719461445 406
184 iso_pr_bacteria 2778261152 2779036765 406
185 iso_pr_bacteria 2778261153 2779041058 406
186 iso_pr_bacteria 2822856742 2822860157 406
187 iso_pr_bacteria 2824588292 2824590845 406
188 iso_pr_bacteria 2859315706 2859315804 406
189 iso_pr_bacteria 2864804954 2864807184 406
190 iso_pr_bacteria 2864840607 2864842562 406
191 iso_pr_bacteria 2864843793 2864846191 406
192 iso_pr_bacteria 2864863795 2864865717 406
193 iso_pr_bacteria 2874434233 2874436939 406
194 iso_pr_bacteria 2874504452 2874507824 406
195 iso_pr_bacteria 2878947168 2878950861 406
196 iso_pr_bacteria 2922113941 2922118170 406
197 iso_pr_bacteria 2937735258 2937736970 406
198 iso_pr_bacteria 2937751072 2937755318 406
199 iso_pr_bacteria 2958255616 2958260586 406
200 iso_pr_bacteria 2961206375 2961207387 406
201 iso_pr_bacteria 2961232173 2961235959 406
202 iso_pr_bacteria 2961247850 2961251640 406
203 iso_pr_bacteria 2965197371 2965199501 406
204 iso_pr_bacteria 2970791725 2970794650 406
205 iso_pr_bacteria 2978102237 2978105836 406
206 iso_pr_bacteria 2978161719 2978164215 406
207 iso_pr_bacteria 2996406003 2996407199 406
208 iso_pr_bacteria 2996467878 2996470181 406
209 iso_pr_bacteria 3007994558 3007994659 406
210 iso_pr_bacteria 8004118532 8004120383 406
211 iso_pr_bacteria 8004285568 8004289909 406
212 iso_pr_bacteria 8004307473 8004311560 406
213 iso_pr_bacteria 8004541719 8004544396 406
214 iso_pr_bacteria 8004571736 8004574248 406
215 iso_pr_bacteria 8004582426 8004587323 406
216 iso_pr_bacteria 8021540981 8021545320 406
217 iso_pr_bacteria 8021546568 8021552232 406
218 iso_pr_bacteria 8028002147 8028002980 406
219 iso_pr_bacteria 8071322446 8071324464 406
220 iso_pr_bacteria 8071333649 8071335546 406
221 iso_pr_bacteria 8071343737 8071345520 406
222 iso_pr_bacteria 8073124432 8073125156 406
223 iso_pr_bacteria 8101676404 8101679662 406
224 iso_pr_bacteria 8101680043 8101683476 406
225 iso_pr_bacteria 8101683685 8101686748 406
226 3300012846 Ga0160433_100155 Ga0160433_10015542 407
227 iso_pr_bacteria 2531839602 2534151037 407
228 iso_pr_bacteria 2597489902 2597920632 407
229 iso_pr_bacteria 2836714267 2836717262 407
230 iso_pr_bacteria 2850131454 2850134479 407
231 iso_pr_bacteria 2896187957 2896188540 407
232 iso_pr_bacteria 3006190525 3006193694 407
233 iso_pr_bacteria 3007473699 3007474128 407
234 3300042593 Ga0466691_079274 Ga0466691_079274_3248_4474 408
235 3300042655 Ga0466727_118354 Ga0466727_118354_1526_2755 409
236 iso_pr_bacteria 2508501067 2508839643 409
237 iso_pr_bacteria 2828301124 2828303652 409
238 3300012798 Ga0160454_100224 Ga0160454_10022412 410
239 3300012835 Ga0160446_101339 Ga0160446_1013392 410
240 3300012861 Ga0160436_1000567 Ga0160436_10005674 410
241 iso_pr_bacteria 8035422605 8035426758 410
242 iso_pr_bacteria 2548876789 2549850174 411
243 iso_pr_bacteria 2864761044 2864761118 413
244 3300012850 Ga0160434_100510 Ga0160434_1005108 414
245 iso_pr_bacteria 2517572100 2517756242 414
246 iso_pr_bacteria 2639763185 2642345675 414
247 iso_pr_bacteria 2639763186 2642350584 414
248 iso_pr_bacteria 2857493320 2857495779 414
249 iso_pr_bacteria 2857493320 2857496041 414
250 iso_pr_bacteria 2857498920 2857501347 414
251 3300012861 Ga0160436_1000547 Ga0160436_10005475 416
252 iso_pr_bacteria 2681813507 2684383846 417
253 3300012832 Ga0160458_100074 Ga0160458_10007474 418
254 iso_pr_bacteria 8100455565 8100459659 422
255 iso_pr_bacteria 8100461708 8100464671 422
256 3300007224 Ga0104147_1027984 Ga0104147_10279846 423
257 iso_pr_bacteria 2820110010 2820111432 430
258 3300009784 Ga0123357_10030840 Ga0123357_100308404 431
259 iso_pr_bacteria 8101265296 8101266468 441
260 iso_pr_bacteria 8101267702 8101269705 441
261 iso_pr_bacteria 8101278866 8101280851 441
262 3300000479 SCG598P14_112701 SCG598P14_11270116 442
263 3300007153 Ga0104050_1001141 Ga0104050_10011412 444
264 2044078006 SPBB_contig11524 SPBB_334520 449

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07690 MFS_1 Major Facilitator Superfamily 211 384 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.