Protein Family IF00042

Metagenome Isolate
264 Members
209 Samples
119 Scaffolds
400.87 Avg Length

🧬 Representative Sequence

ID
2044078006|SPBB_contig11524|SPBB_334520
Length
449 aa
Sequence
MRIIGAVALAHLINDLIQAVLPSIYPMLKQSYGLTFTQVGLITLAFQLTASLLQPWVGYYTDRHPKPYLLPMGMICTLIGILMMSQVGSFPLILLASALIGIGSSTFHPEASRVARLASGGRFGLAQSTFQVGGNAGTAFGPLLAAAIIIPYGQGNVAWFGLFAVFALVVLYAISRWYANHLRLFKLKQGQAATHGLSKARVLSALVVLGLLVFSKYFYMSSFTSYFTFYLIEKFDLSVASSQLHLFLFLGAVAAGTFFGGPIGDRIGRKAVIWFSILGVAPFTLILPHVDLFWTSVLSVVIGFILASAFSAIVVYAQELVPGNVGMIAGVFFGLMFGFGGIGAALLGYVADAHGIEYVYRLCAYLPLFGILAIFLPRSKKPDRPRACPRSVSCVADRSRVTQLPPLSSNRPASAGRKRCRALYEKGFRFFLFLNDIHLHYNRAFLSAP

📊 Sample Types

Isolate 54.9%
Metagenome 45.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 22.1%
Unclassified 16.9%
Curculionidae 7.2%
Culicidae 6.7%
Drosophilidae 6.7%
Anthocoridae 6.7%
Elmidae 6.2%
Tenebrionidae 4.1%
Kalotermitidae 3.6%
Armadillidiidae 3.1%
Termitidae 3.1%
Cerambycidae 2.1%
Calliphoridae 2.1%
Tephritidae 1.5%
Termopsidae 1.5%
Passalidae 1.0%
Pentatomidae 1.0%
Rhinotermitidae 1.0%
Ceratophyllidae 0.5%
Pteromalidae 0.5%
Siricidae 0.5%
Formicidae 0.5%
Rhopalidae 0.5%
Carabidae 0.5%
Plutellidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 249
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
2 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
3 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
4 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
5 2703719240 Serratia marcescens ano2 Isolate Unclassified
6 2864755708 Massilia timonae S00006 Isolate Elmidae
7 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
8 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
11 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
12 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
13 8100455565 Delftia sp. S67 Isolate Curculionidae
14 8101255641 Snodgrassella sp. M0110 Isolate Apidae
15 8101260589 Snodgrassella sp. M0118 Isolate Apidae
16 8101267702 Snodgrassella sp. W6238H14 Isolate Apidae
17 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
18 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
19 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
20 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
21 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
22 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
25 2684622927 Snodgrassella alvi Sa_196 Isolate Unclassified
26 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
27 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
28 2838140227 Dyella sp. OAE510 Isolate Unclassified
29 2846368606 Snodgrassella alvi A-11-12 Isolate Apidae
30 2849404451 Snodgrassella alvi E1 Isolate Apidae
31 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
32 2854088767 Snodgrassella alvi MS1-3 Isolate Apidae
33 2857840086 Snodgrassella alvi Aw-20 Isolate Apidae
34 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
35 8018312681 Enterobacter sp. OLF Isolate Tephritidae
36 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
37 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
38 8099192374 Erwinia typographi IC4 Isolate Curculionidae
39 2978161719 Serratia marcescens KZ2 Isolate Apidae
40 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
41 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
42 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
43 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
44 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
45 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
49 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
50 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
51 2836714267 Shimwellia blattae NCTC10965 Isolate
52 2840748007 Snodgrassella alvi A-1-12 Isolate Apidae
53 2846363972 Snodgrassella alvi N-W7 Isolate Apidae
54 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
55 2849406737 Snodgrassella alvi PEB0178 Isolate Apidae
56 2849415715 Snodgrassella alvi A2 Isolate Apidae
57 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
58 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
59 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
60 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
61 637000219 Pseudomonas entomophila L48 Isolate Unclassified
62 8021546568 Klebsiella sp. Kps Isolate Tephritidae
63 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
64 8071322446 Escherichia coli PN122 Isolate Calliphoridae
65 8101263066 Snodgrassella sp. M0351 Isolate Apidae
66 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
67 2971189173 Yersinia pestis A-1249 Isolate Unclassified
68 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
69 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
70 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
71 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
72 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
73 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
74 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
75 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
76 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
77 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
78 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
79 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
80 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
81 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
82 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
83 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
84 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
85 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
86 2849402121 Snodgrassella alvi A-10-12 Isolate Apidae
87 2849409164 Snodgrassella alvi wkB298 Isolate Apidae
88 2854091108 Snodgrassella alvi wkB339 Isolate Apidae
89 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
90 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
91 2937735258 Serratia marcescens KZ11 Isolate Apidae
92 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
93 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
94 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
95 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
96 8100461708 Delftia sp. S65 Isolate Curculionidae
97 8101272231 Snodgrassella sp. W8132 Isolate Apidae
98 2978102237 Serratia fonticola AeS1 Isolate Culicidae
99 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
100 3007994558 Escherichia alba B35 Isolate Tenebrionidae
101 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
102 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
103 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
104 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
105 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
106 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
107 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
108 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
109 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
110 2811994808 Snodgrassella alvi Sa_196 v2 Isolate Unclassified
111 2846361553 Snodgrassella alvi PEB0171 Isolate Apidae
112 2852205774 Snodgrassella alvi ESL0196 Isolate Apidae
113 2854086477 Snodgrassella alvi N-S3 Isolate Apidae
114 2854097802 Snodgrassella alvi Aw-18 Isolate Apidae
115 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
116 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
117 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
118 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
119 2958255616 Serratia marcescens TM Isolate
120 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
121 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
122 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
123 8071333649 Escherichia coli PN108 Isolate Calliphoridae
124 8101265296 Snodgrassella sp. W8158 Isolate Apidae
125 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
126 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
127 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
128 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
129 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
130 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
131 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
132 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
133 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
134 2585428136 Snodgrassella alvi wkB2 Isolate Apidae
135 2718217944 Serratia marcescens AS1 Isolate Culicidae
136 8119099601 Snodgrassella alvi wkB2 Isolate Apidae
137 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
138 2854100132 Snodgrassella alvi A-2-12 Isolate Apidae
139 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
140 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
141 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
142 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
143 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
144 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
145 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
146 8101270055 Snodgrassella sp. W8124 Isolate Apidae
147 8101278866 Snodgrassella sp. W6238H11 Isolate Apidae
148 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
149 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
150 3300000475 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 Metagenome Apidae
151 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
152 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
153 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
154 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
155 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
156 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
157 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
158 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
159 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
160 2703719239 Serratia marcescens ano1 Isolate Unclassified
161 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
162 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
163 2849411303 Snodgrassella alvi A3 Isolate Apidae
164 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
165 2857835046 Snodgrassella alvi wkB9 Isolate Apidae
166 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
167 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
168 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
169 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
170 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
171 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
172 8004541719 Serratia marcescens KZ19 Isolate Apidae
173 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
174 8035422605 Pseudomonas monteilii CY06 Isolate
175 8101274435 Snodgrassella sp. W8134 Isolate Apidae
176 8101276651 Snodgrassella sp. W8135 Isolate Apidae
177 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
178 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
179 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
180 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
181 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
182 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
183 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
184 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
185 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
186 2834412944 Snodgrassella alvi A-5-24 Isolate Apidae
187 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
188 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
189 2857825141 Snodgrassella alvi wkB332 Isolate Apidae
190 2857830159 Snodgrassella alvi A-9-24 Isolate Apidae
191 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
192 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
193 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
194 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
195 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
196 8052469819 Pseudomonas putida DZ-F23 Isolate
197 8071343737 Escherichia coli PN119 Isolate Calliphoridae
198 8101258116 Snodgrassella sp. M0112 Isolate Apidae
199 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
200 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
201 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
202 3300000479 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 Metagenome Apidae
203 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
204 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
205 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
206 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
207 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
208 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
209 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 DPO_contig06369 2032320009 Unclassified 6563
2 Ga0104041_1030476 3300007106 Bacteria 5327
3 Ga0466701_055000 3300042598 Bacteria 242806
4 Ga0466713_050958 3300042602 Bacteria 35586
5 Ga0160472_101074 3300012839 Bacteria 9449
6 Ga0160443_100167 3300012848 Bacteria 91984
7 Ga0160447_100415 3300012849 Bacteria 21005
8 Ga0160436_1000567 3300012861 Bacteria 13466
9 Ga0466692_003819 3300042591 Bacteria 6401
10 Ga0466696_059542 3300042596 Bacteria 6598
11 Ga0466705_358543 3300042612 Bacteria 7634
12 Ga0466704_230523 3300042643 Bacteria 1484
13 Ga0466724_47936 3300042649 Bacteria 19059
14 Ga0466724_60368 3300042649 Bacteria 50984
15 Ga0466708_094676 3300042652 Bacteria 157715
16 SPBB_contig00360 2044078006 Bacteria 40893
17 FGTW_contig30555 2065487013 Bacteria 12633
18 2227614355 2225789004 Bacteria 2237
19 IMNBL1DRAFT_c0002597 3300000062 Bacteria 12416
20 JGI24702J35022_10017697 3300002462 Bacteria 3891
21 Ga0104049_1131284 3300007103 Bacteria 2870
22 Ga0160454_100224 3300012798 Bacteria 57381
23 Ga0160458_100074 3300012832 Bacteria 123747
24 Ga0160472_100574 3300012839 Unclassified 21341
25 Ga0160430_100002 3300012852 Bacteria 510179
26 Ga0160436_1006530 3300012861 Unclassified 2695
27 Ga0247289_0300 3300035363 Unclassified 8775
28 Ga0466730_009057 3300042625 Bacteria 8760
29 Ga0466704_075067 3300042643 Bacteria 20540
30 Ga0466724_06065 3300042649 Bacteria 94573
31 Ga0466711_044119 3300042615 Bacteria 2950
32 HBC_ctgsDRAFT_1013222 3300000333 Unclassified 1986
33 Meta3P_1000236 3300002464 Bacteria 24894
34 Ga0104040_1039457 3300007149 Bacteria 5340
35 Ga0104147_1027984 3300007224 Bacteria 12805
36 Ga0123357_10024752 3300009784 Bacteria 8090
37 Ga0466701_019405 3300042598 Bacteria 47076
38 Ga0466707_064926 3300042601 Bacteria 3850
39 Ga0160453_100016 3300012814 Bacteria 266659
40 Ga0160467_102188 3300012829 Bacteria 4812
41 Ga0160446_101339 3300012835 Bacteria 5470
42 Ga0160460_101203 3300012845 Bacteria 9714
43 Ga0160435_1000298 3300012857 Bacteria 21126
44 Ga0466735_143378 3300042624 Bacteria 3964
45 Ga0466735_170596 3300042624 Bacteria 3429
46 Ga0466730_019112 3300042625 Unclassified 4349
47 Ga0466730_053692 3300042625 Bacteria 19216
48 Ga0466724_23693 3300042649 Bacteria 54133
49 Ga0466724_54961 3300042649 Bacteria 72912
50 Ga0466724_64498 3300042649 Bacteria 13151
51 Ga0466727_118354 3300042655 Bacteria 4444
52 Ga0466705_448479 3300042612 Bacteria 2185
53 SPBB_contig11524 2044078006 Bacteria 77152
54 SWWA_contig31857__length_4576___numreads_238 2100351016 Unclassified 4576
55 2227247477 2225789004 Unclassified 7161
56 HBC_ctgsDRAFT_1008214 3300000333 Bacteria 2471
57 Meta3P_1000705 3300002464 Unclassified 11343
58 Ga0063521_1000082 3300003973 Bacteria 78761
59 Ga0074278_109326 3300005721 Bacteria 18720
60 Ga0104042_1035014 3300007130 Bacteria 3467
61 Ga0104050_1001141 3300007153 Bacteria 13085
62 Ga0123357_10008532 3300009784 Bacteria 12816
63 Ga0123354_10004897 3300010882 Bacteria 19199
64 Ga0466701_031174 3300042598 Bacteria 92921
65 Ga0466707_022169 3300042601 Bacteria 38620
66 Ga0466707_233833 3300042601 Bacteria 1571
67 Ga0160432_100496 3300012818 Bacteria 24900
68 Ga0160435_1000142 3300012857 Bacteria 40334
69 Ga0466696_215115 3300042596 Bacteria 1580
70 Ga0466730_029041 3300042625 Bacteria 10891
71 Ga0466724_51867 3300042649 Unclassified 19042
72 IMNBL1DRAFT_c0001827 3300000062 Bacteria 15502
73 SCG598P14_112701 3300000479 Bacteria 35504
74 Ga0466701_036438 3300042598 Bacteria 169982
75 Ga0466707_014260 3300042601 Bacteria 17940
76 Ga0466713_014081 3300042602 Bacteria 234884
77 Ga0466719_561542 3300042606 Bacteria 2448
78 Ga0160468_100256 3300012819 Bacteria 28144
79 Ga0160434_100510 3300012850 Bacteria 10217
80 Ga0160430_106571 3300012852 Bacteria 2460
81 Ga0160436_1000547 3300012861 Bacteria 13800
82 Ga0466724_03330 3300042649 Bacteria 44563
83 Ga0466724_05777 3300042649 Unclassified 50607
84 Ga0466724_68222 3300042649 Unclassified 21408
85 Ga0105005_1032384 3300007505 Bacteria 8519
86 Ga0562377_0001 3300056842 Bacteria 5082480
87 Ga0123357_10134869 3300009784 Bacteria 3057
88 Ga0466713_148277 3300042602 Bacteria 181035
89 Ga0160445_100004 3300012847 Bacteria 501773
90 Ga0265387_1000108 3300024582 Bacteria 19205
91 Ga0466726_429877 3300042619 Bacteria 26082
92 DPO_contig06785 2032320009 Bacteria 13966
93 IMNBL1DRAFT_c0011878 3300000062 Bacteria 4028
94 Ga0562379_0001 3300056790 Bacteria 4904077
95 Ga0562377_0002 3300056842 Bacteria 4351833
96 Ga0562376_0001 3300056857 Bacteria 4828905
97 Ga0160465_100240 3300012803 Bacteria 40681
98 Ga0160465_100382 3300012803 Unclassified 24074
99 Ga0160466_100384 3300012809 Bacteria 25001
100 Ga0466722_140100 3300042609 Bacteria 12281
101 Ga0160469_100258 3300012824 Unclassified 39532
102 Ga0160443_102165 3300012848 Bacteria 4745
103 Ga0160443_104787 3300012848 Bacteria 1963
104 Ga0466696_285572 3300042596 Bacteria 5366
105 Ga0466705_061189 3300042612 Bacteria 19164
106 2227080769 2225789004 Bacteria 257506
107 2227530177 2225789004 Bacteria 16424
108 SCG598J21_12951 3300000475 Bacteria 44371
109 CVPL010L_1001188 3300002932 Unclassified 5759
110 Ga0123357_10030840 3300009784 Bacteria 7273
111 Ga0466707_269881 3300042601 Bacteria 1558
112 Ga0160431_100262 3300012828 Bacteria 33659
113 Ga0160433_100155 3300012846 Bacteria 58519
114 Ga0466691_079274 3300042593 Bacteria 5036
115 Ga0466730_001041 3300042625 Bacteria 1802
116 Ga0466730_007214 3300042625 Bacteria 2834
117 Ga0466730_013284 3300042625 Bacteria 61349
118 Ga0466730_087551 3300042625 Bacteria 89610
119 Ga0466724_60162 3300042649 Bacteria 60503

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_285572 Ga0466696_285572_1378_2505 357
2 3300012848 Ga0160443_104787 Ga0160443_1047872 360
3 3300012848 Ga0160443_100167 Ga0160443_10016771 361
4 2225789004 2227614355 2228188269 369
5 3300042643 Ga0466704_075067 Ga0466704_075067_1438_2658 374
6 3300000062 IMNBL1DRAFT_c0011878 IMNBL1DRAFT_00118783 375
7 3300002932 CVPL010L_1001188 CVPL010L_10011883 376
8 3300012824 Ga0160469_100258 Ga0160469_1002582 376
9 3300042649 Ga0466724_64498 Ga0466724_64498_5909_7129 376
10 2225789004 2227530177 2228041550 377
11 3300002464 Meta3P_1000705 Meta3P_10007056 377
12 3300012819 Ga0160468_100256 Ga0160468_1002562 377
13 3300042596 Ga0466696_215115 Ga0466696_215115_298_1488 377
14 3300042615 Ga0466711_044119 Ga0466711_044119_146_1357 378
15 3300002464 Meta3P_1000236 Meta3P_10002367 379
16 3300010882 Ga0123354_10004897 Ga0123354_1000489716 379
17 iso_pr_bacteria 2585428136 2588037184 380
18 iso_pr_bacteria 2857835046 2857836971 380
19 iso_pr_bacteria 8119099601 8119100281 380
20 3300042601 Ga0466707_269881 Ga0466707_269881_95_1270 381
21 iso_pr_bacteria 2864751016 2864752563 381
22 2032320009 DPO_contig06369 DPOB_354810 382
23 2032320009 DPO_contig06785 DPOB_173050 382
24 2044078006 SPBB_contig00360 SPBB_149810 382
25 2100351016 SWWA_contig31857__length_4576___numreads_238 SWWA_02682570 382
26 3300042598 Ga0466701_019405 Ga0466701_019405_31444_32592 382
27 3300042625 Ga0466730_053692 Ga0466730_053692_6113_7315 382
28 3300012809 Ga0160466_100384 Ga0160466_10038422 383
29 iso_pr_bacteria 2864755708 2864760731 384
30 2225789004 2227247477 2227689569 385
31 3300012839 Ga0160472_100574 Ga0160472_1005742 385
32 3300012861 Ga0160436_1006530 Ga0160436_10065302 385
33 3300042612 Ga0466705_358543 Ga0466705_358543_6183_7403 385
34 2225789004 2227080769 2227450444 387
35 3300042612 Ga0466705_448479 Ga0466705_448479_855_2057 388
36 3300056857 Ga0562376_0001 Ga0562376_0001_1207235_1208455 388
37 3300000333 HBC_ctgsDRAFT_1008214 HBC_ctgsDRAFT_10082142 389
38 3300005721 Ga0074278_109326 Ga0074278_10932621 389
39 3300009784 Ga0123357_10024752 Ga0123357_100247528 390
40 3300042624 Ga0466735_170596 Ga0466735_170596_1064_2287 390
41 3300042649 Ga0466724_51867 Ga0466724_51867_2622_3818 390
42 3300009784 Ga0123357_10008532 Ga0123357_100085323 391
43 3300012829 Ga0160467_102188 Ga0160467_1021883 391
44 3300042596 Ga0466696_059542 Ga0466696_059542_3736_4968 391
45 3300042598 Ga0466701_055000 Ga0466701_055000_453_1652 391
46 3300042609 Ga0466722_140100 Ga0466722_140100_2684_3862 392
47 3300000062 IMNBL1DRAFT_c0002597 IMNBL1DRAFT_00025974 393
48 3300042591 Ga0466692_003819 Ga0466692_003819_5092_6273 393
49 3300012852 Ga0160430_106571 Ga0160430_1065713 394
50 3300042624 Ga0466735_143378 Ga0466735_143378_1061_2245 394
51 3300009784 Ga0123357_10134869 Ga0123357_101348693 395
52 3300012818 Ga0160432_100496 Ga0160432_10049620 395
53 3300012857 Ga0160435_1000142 Ga0160435_100014229 395
54 3300042601 Ga0466707_014260 Ga0466707_014260_9504_10691 395
55 3300042619 Ga0466726_429877 Ga0466726_429877_4067_5254 395
56 3300042625 Ga0466730_029041 Ga0466730_029041_1547_2767 395
57 3300042649 Ga0466724_68222 Ga0466724_68222_15527_16747 395
58 3300042606 Ga0466719_561542 Ga0466719_561542_1104_2294 396
59 3300042612 Ga0466705_061189 Ga0466705_061189_13115_14305 396
60 3300042652 Ga0466708_094676 Ga0466708_094676_123393_124583 396
61 3300012839 Ga0160472_101074 Ga0160472_1010745 397
62 3300012845 Ga0160460_101203 Ga0160460_1012035 397
63 3300012852 Ga0160430_100002 Ga0160430_100002290 397
64 3300012814 Ga0160453_100016 Ga0160453_100016149 398
65 3300012847 Ga0160445_100004 Ga0160445_100004182 398
66 3300035363 Ga0247289_0300 Ga0247289_0300_2726_3946 398
67 3300042602 Ga0466713_148277 Ga0466713_148277_167536_168756 398
68 3300042625 Ga0466730_007214 Ga0466730_007214_889_2109 398
69 3300042625 Ga0466730_013284 Ga0466730_013284_52063_53283 398
70 3300042625 Ga0466730_019112 Ga0466730_019112_2477_3697 398
71 iso_pr_bacteria 2938192669 2938196461 398
72 3300012848 Ga0160443_102165 Ga0160443_1021652 399
73 3300024582 Ga0265387_1000108 Ga0265387_10001085 399
74 3300042602 Ga0466713_050958 Ga0466713_050958_1243_2442 399
75 3300042649 Ga0466724_47936 Ga0466724_47936_2619_3818 399
76 iso_pr_bacteria 2684622927 2686106081 399
77 iso_pr_bacteria 2811994808 2812042491 399
78 iso_pr_bacteria 2834412944 2834414501 399
79 iso_pr_bacteria 2840748007 2840748337 399
80 iso_pr_bacteria 2846359427 2846359579 399
81 iso_pr_bacteria 2846361553 2846363580 399
82 iso_pr_bacteria 2846363972 2846366008 399
83 iso_pr_bacteria 2846368606 2846370050 399
84 iso_pr_bacteria 2846379220 2846380568 399
85 iso_pr_bacteria 2849402121 2849403706 399
86 iso_pr_bacteria 2849404451 2849404593 399
87 iso_pr_bacteria 2849406737 2849407081 399
88 iso_pr_bacteria 2849409164 2849409690 399
89 iso_pr_bacteria 2849411303 2849413352 399
90 iso_pr_bacteria 2849415715 2849416573 399
91 iso_pr_bacteria 2852205774 2852205957 399
92 iso_pr_bacteria 2854086477 2854088764 399
93 iso_pr_bacteria 2854088767 2854091106 399
94 iso_pr_bacteria 2854091108 2854093049 399
95 iso_pr_bacteria 2854097802 2854099901 399
96 iso_pr_bacteria 2854100132 2854101686 399
97 iso_pr_bacteria 2857825141 2857826321 399
98 iso_pr_bacteria 2857830159 2857832411 399
99 iso_pr_bacteria 2857840086 2857842407 399
100 iso_pr_bacteria 8101255641 8101255968 399
101 iso_pr_bacteria 8101258116 8101258362 399
102 iso_pr_bacteria 8101260589 8101261444 399
103 iso_pr_bacteria 8101263066 8101265105 399
104 iso_pr_bacteria 8101270055 8101271956 399
105 iso_pr_bacteria 8101272231 8101274261 399
106 iso_pr_bacteria 8101274435 8101276475 399
107 iso_pr_bacteria 8101276651 8101278573 399
108 3300000333 HBC_ctgsDRAFT_1013222 HBC_ctgsDRAFT_10132221 400
109 3300000475 SCG598J21_12951 SCG598J21_129511 400
110 3300042649 Ga0466724_06065 Ga0466724_06065_35953_37185 400
111 3300042649 Ga0466724_23693 Ga0466724_23693_5584_6816 400
112 iso_pr_bacteria 8018312681 8018315237 400
113 iso_pr_bacteria 8099192374 8099195758 400
114 2065487013 FGTW_contig30555 FGTW_01490980 401
115 3300000062 IMNBL1DRAFT_c0001827 IMNBL1DRAFT_00018274 401
116 3300002462 JGI24702J35022_10017697 JGI24702J35022_100176972 401
117 3300042601 Ga0466707_022169 Ga0466707_022169_460_1680 401
118 3300042649 Ga0466724_60162 Ga0466724_60162_46294_47529 401
119 iso_pr_bacteria 2997878596 2997879261 401
120 3300012828 Ga0160431_100262 Ga0160431_10026213 402
121 3300012849 Ga0160447_100415 Ga0160447_10041516 402
122 3300012857 Ga0160435_1000298 Ga0160435_10002984 402
123 3300042598 Ga0466701_036438 Ga0466701_036438_142262_143530 402
124 3300042601 Ga0466707_064926 Ga0466707_064926_218_1426 402
125 3300042601 Ga0466707_233833 Ga0466707_233833_122_1330 402
126 3300042643 Ga0466704_230523 Ga0466704_230523_254_1462 402
127 iso_pr_bacteria 2833053935 2833055797 402
128 iso_pr_bacteria 2864739902 2864740590 402
129 3300003973 Ga0063521_1000082 Ga0063521_100008226 403
130 3300042649 Ga0466724_05777 Ga0466724_05777_14628_15839 403
131 iso_pr_bacteria 2837516909 2837517682 403
132 iso_pr_bacteria 2846386538 2846387741 403
133 iso_pr_bacteria 2864745180 2864745798 403
134 iso_pr_bacteria 2864853652 2864857647 403
135 3300012803 Ga0160465_100240 Ga0160465_1002405 404
136 3300012803 Ga0160465_100382 Ga0160465_1003827 404
137 3300042598 Ga0466701_031174 Ga0466701_031174_33538_34752 404
138 3300042625 Ga0466730_009057 Ga0466730_009057_1177_2391 404
139 3300042649 Ga0466724_03330 Ga0466724_03330_28715_29929 404
140 3300042649 Ga0466724_60368 Ga0466724_60368_30576_31790 404
141 3300056790 Ga0562379_0001 Ga0562379_0001_4021103_4022317 404
142 3300056842 Ga0562377_0001 Ga0562377_0001_2580678_2581892 404
143 3300056842 Ga0562377_0002 Ga0562377_0002_2626329_2627543 404
144 iso_pr_bacteria 2529292851 2530232667 404
145 iso_pr_bacteria 2838140227 2838143692 404
146 iso_pr_bacteria 2841260384 2841260518 404
147 iso_pr_bacteria 2864926767 2864932013 404
148 iso_pr_bacteria 2971189173 2971193237 404
149 iso_pr_bacteria 3004010258 3004013322 404
150 iso_pr_bacteria 3007478678 3007480979 404
151 iso_pr_bacteria 637000219 637999935 404
152 iso_pr_bacteria 8006199443 8006199635 404
153 iso_pr_bacteria 8011329375 8011330223 404
154 iso_pr_bacteria 8035422605 8035424776 404
155 iso_pr_bacteria 8052469819 8052474214 404
156 iso_pr_bacteria 2519899622 2520386584 405
157 iso_pr_bacteria 2519899623 2520396504 405
158 iso_pr_bacteria 2835335304 2835339839 405
159 iso_pr_bacteria 2847708326 2847709251 405
160 iso_pr_bacteria 2864847319 2864851352 405
161 iso_pr_bacteria 2990166910 2990172106 405
162 iso_pr_bacteria 8001059720 8001060466 405
163 iso_pr_bacteria 8035321120 8035322184 405
164 iso_pr_bacteria 8035326735 8035327768 405
165 3300007103 Ga0104049_1131284 Ga0104049_11312843 406
166 3300007106 Ga0104041_1030476 Ga0104041_10304764 406
167 3300007130 Ga0104042_1035014 Ga0104042_10350143 406
168 3300007149 Ga0104040_1039457 Ga0104040_10394573 406
169 3300007505 Ga0105005_1032384 Ga0105005_10323841 406
170 3300042602 Ga0466713_014081 Ga0466713_014081_184919_186139 406
171 3300042625 Ga0466730_001041 Ga0466730_001041_309_1529 406
172 3300042625 Ga0466730_087551 Ga0466730_087551_72789_74009 406
173 3300042649 Ga0466724_54961 Ga0466724_54961_56157_57377 406
174 iso_pr_bacteria 2507262057 2507518040 406
175 iso_pr_bacteria 2537561600 2537924885 406
176 iso_pr_bacteria 2547132185 2547710498 406
177 iso_pr_bacteria 2551306516 2553377659 406
178 iso_pr_bacteria 2551306531 2553450162 406
179 iso_pr_bacteria 2588253732 2588528090 406
180 iso_pr_bacteria 2588253791 2588728934 406
181 iso_pr_bacteria 2703719239 2706049570 406
182 iso_pr_bacteria 2703719240 2706054848 406
183 iso_pr_bacteria 2718217944 2719461445 406
184 iso_pr_bacteria 2778261152 2779036765 406
185 iso_pr_bacteria 2778261153 2779041058 406
186 iso_pr_bacteria 2822856742 2822860157 406
187 iso_pr_bacteria 2824588292 2824590845 406
188 iso_pr_bacteria 2859315706 2859315804 406
189 iso_pr_bacteria 2864804954 2864807184 406
190 iso_pr_bacteria 2864840607 2864842562 406
191 iso_pr_bacteria 2864843793 2864846191 406
192 iso_pr_bacteria 2864863795 2864865717 406
193 iso_pr_bacteria 2874434233 2874436939 406
194 iso_pr_bacteria 2874504452 2874507824 406
195 iso_pr_bacteria 2878947168 2878950861 406
196 iso_pr_bacteria 2922113941 2922118170 406
197 iso_pr_bacteria 2937735258 2937736970 406
198 iso_pr_bacteria 2937751072 2937755318 406
199 iso_pr_bacteria 2958255616 2958260586 406
200 iso_pr_bacteria 2961206375 2961207387 406
201 iso_pr_bacteria 2961232173 2961235959 406
202 iso_pr_bacteria 2961247850 2961251640 406
203 iso_pr_bacteria 2965197371 2965199501 406
204 iso_pr_bacteria 2970791725 2970794650 406
205 iso_pr_bacteria 2978102237 2978105836 406
206 iso_pr_bacteria 2978161719 2978164215 406
207 iso_pr_bacteria 2996406003 2996407199 406
208 iso_pr_bacteria 2996467878 2996470181 406
209 iso_pr_bacteria 3007994558 3007994659 406
210 iso_pr_bacteria 8004118532 8004120383 406
211 iso_pr_bacteria 8004285568 8004289909 406
212 iso_pr_bacteria 8004307473 8004311560 406
213 iso_pr_bacteria 8004541719 8004544396 406
214 iso_pr_bacteria 8004571736 8004574248 406
215 iso_pr_bacteria 8004582426 8004587323 406
216 iso_pr_bacteria 8021540981 8021545320 406
217 iso_pr_bacteria 8021546568 8021552232 406
218 iso_pr_bacteria 8028002147 8028002980 406
219 iso_pr_bacteria 8071322446 8071324464 406
220 iso_pr_bacteria 8071333649 8071335546 406
221 iso_pr_bacteria 8071343737 8071345520 406
222 iso_pr_bacteria 8073124432 8073125156 406
223 iso_pr_bacteria 8101676404 8101679662 406
224 iso_pr_bacteria 8101680043 8101683476 406
225 iso_pr_bacteria 8101683685 8101686748 406
226 3300012846 Ga0160433_100155 Ga0160433_10015542 407
227 iso_pr_bacteria 2531839602 2534151037 407
228 iso_pr_bacteria 2597489902 2597920632 407
229 iso_pr_bacteria 2836714267 2836717262 407
230 iso_pr_bacteria 2850131454 2850134479 407
231 iso_pr_bacteria 2896187957 2896188540 407
232 iso_pr_bacteria 3006190525 3006193694 407
233 iso_pr_bacteria 3007473699 3007474128 407
234 3300042593 Ga0466691_079274 Ga0466691_079274_3248_4474 408
235 3300042655 Ga0466727_118354 Ga0466727_118354_1526_2755 409
236 iso_pr_bacteria 2508501067 2508839643 409
237 iso_pr_bacteria 2828301124 2828303652 409
238 3300012798 Ga0160454_100224 Ga0160454_10022412 410
239 3300012835 Ga0160446_101339 Ga0160446_1013392 410
240 3300012861 Ga0160436_1000567 Ga0160436_10005674 410
241 iso_pr_bacteria 8035422605 8035426758 410
242 iso_pr_bacteria 2548876789 2549850174 411
243 iso_pr_bacteria 2864761044 2864761118 413
244 3300012850 Ga0160434_100510 Ga0160434_1005108 414
245 iso_pr_bacteria 2517572100 2517756242 414
246 iso_pr_bacteria 2639763185 2642345675 414
247 iso_pr_bacteria 2639763186 2642350584 414
248 iso_pr_bacteria 2857493320 2857495779 414
249 iso_pr_bacteria 2857493320 2857496041 414
250 iso_pr_bacteria 2857498920 2857501347 414
251 3300012861 Ga0160436_1000547 Ga0160436_10005475 416
252 iso_pr_bacteria 2681813507 2684383846 417
253 3300012832 Ga0160458_100074 Ga0160458_10007474 418
254 iso_pr_bacteria 8100455565 8100459659 422
255 iso_pr_bacteria 8100461708 8100464671 422
256 3300007224 Ga0104147_1027984 Ga0104147_10279846 423
257 iso_pr_bacteria 2820110010 2820111432 430
258 3300009784 Ga0123357_10030840 Ga0123357_100308404 431
259 iso_pr_bacteria 8101265296 8101266468 441
260 iso_pr_bacteria 8101267702 8101269705 441
261 iso_pr_bacteria 8101278866 8101280851 441
262 3300000479 SCG598P14_112701 SCG598P14_11270116 442
263 3300007153 Ga0104050_1001141 Ga0104050_10011412 444
264 2044078006 SPBB_contig11524 SPBB_334520 449

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07690 MFS_1 Major Facilitator Superfamily 211 384 0.89

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6kkl-assembly1.cif.gz_A Crystal structure of Drug:Proton Antiporter-1 (DHA1) Family SotB, in the inward conformation (H115N mutant) 0.838 4 376
6e9n-assembly2.cif.gz_B E. coli D-galactonate:proton symporter in the inward open form 0.838 4 376
8g92-assembly1.cif.gz_A Structure of inhibitor 16d-bound SPNS2 0.836 2 376
7yuf-assembly1.cif.gz_R apo human SPNS2 0.83 2 374
8ex4-assembly1.cif.gz_A Human S1P transporter Spns2 in an inward-facing open conformation (state 1) 0.815 2 376
IDDescriptionScoreStartEndSuperfamily
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A; ;MFS general substrate transporter like domains 0.9964 3 183 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A; ;MFS general substrate transporter like domains 0.9903 199 383 1.20.1250.20
af_P39398_32_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A; ;MFS general substrate transporter like domains 0.909 3 174 1.20.1250.20
af_P9WJW9_9_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A; ;MFS general substrate transporter like domains 0.8945 6 173 1.20.1250.20
af_Q03263_69_259_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A; ;MFS general substrate transporter like domains 0.8904 3 172 1.20.1250.20
IDDescriptionScoreStartEndGO Terms
AF-A0A842YDF2-F1-model_v4 Uncharacterized/unreviewed 0.9284 3 174
AF-A0A7W0MZI9-F1-model_v4 Uncharacterized/unreviewed 0.8931 1 266
AF-A0A327KMU6-F1-model_v4 Uncharacterized/unreviewed 0.8839 3 383 GO:0022857
AF-A0A6L7EB22-F1-model_v4 Uncharacterized/unreviewed 0.8742 3 174

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.