Protein Family IF00003

Metagenome Isolate
207 Members
56 Samples
196 Scaffolds
117.29 Avg Length

🧬 Representative Sequence

ID
2030936001|Nasutiter_Contig40690|Nasutiterm_109510
Length
120 aa
Sequence
MLVELLKSKIHRATVTDACLDYEGSITIDKRAYAGGWGFFEHEKVHVLNLNNGERFETYVIEGKSKSGTVCLNGAAARLVQKNDLVIIAAYVSLTPQEAKSWQPRVVKVNAKNKIIDSKK

📊 Sample Types

Isolate 5.3%
Metagenome 94.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🦗 Order Distribution

Amphipoda 0.0%
Anostraca 0.0%
Araneae 0.0%
Blattodea 0.0%
Calanoida 0.0%
Coleoptera 0.0%
Copepoda 0.0%
Decapoda 0.0%
Diplopoda 0.5%
Diplostraca 0.0%
Diptera 0.0%
Euphausiacea 0.0%
Hemiptera 0.0%
Hymenoptera 1.0%
Insect (unknown) 0.0%
Isopoda 1.0%
Isoptera 92.3%
Ixodida 0.0%
Lepidoptera 0.0%
Mecoptera 0.0%
NA 0.0%
Odonata 0.0%
Orthoptera 0.0%
Phthiraptera 0.0%
Psocodea 0.0%
Sarcoptiformes 0.0%
Siphonaptera 0.0%
Spirobolida 0.0%
Thysanoptera 0.0%
Trombidiformes 0.0%

🌳 Taxonomy

Archaea 0
Bacteria 184
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeEnvironment
1 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Hymenoptera
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Isoptera
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Isoptera
4 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Isopoda
5 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Isoptera
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Isoptera
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Isoptera
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Isoptera
9 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Isoptera
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Isoptera
11 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Isoptera
12 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome Isoptera
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Isoptera
14 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Isoptera
15 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Hymenoptera
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Isoptera
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Isoptera
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Isoptera
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Isoptera
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Isoptera
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Isoptera
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Isoptera
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Isoptera
24 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Isoptera
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Isoptera
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Isoptera
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Isoptera
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Isoptera
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome Isoptera
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Isoptera
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Isoptera
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Isoptera
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Isoptera
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Isoptera
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome Isoptera
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Isoptera
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Isoptera
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Isoptera
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Isoptera
40 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Isoptera
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Diplopoda
42 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Isoptera
43 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Isoptera
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Isoptera
45 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Isoptera
46 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Isoptera
47 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Isoptera
48 3300005200 Nasutitermes gut metagenome Metagenome Isoptera
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Isoptera
50 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Isoptera
51 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Isoptera
52 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Isoptera
53 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Isoptera
54 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Isopoda
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Isoptera
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Isoptera

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10038349 3300010049 Bacteria 4465
2 Ga0123356_10063096 3300010049 Bacteria 3462
3 Ga0123356_10073423 3300010049 Unclassified 3217
4 Ga0123353_10719248 3300010167 Bacteria 1397
5 Ga0123353_11196049 3300010167 Bacteria 998
6 JGI24698J34947_10004703 3300002449 Bacteria 7453
7 JGI24697J35500_11194260 3300002507 Unclassified 1613
8 Ga0068305_10007762 3300005083 Bacteria 82937
9 Ga0072941_1151975 3300005201 Bacteria 9512
10 Ga0074263_105271 3300005485 Bacteria 1585
11 Ga0466707_178168 3300042601 Bacteria 3566
12 Ga0466715_499349 3300042616 Bacteria 11319
13 Ga0466657_349192 3300042582 Bacteria 3430
14 Ga0123356_10032105 3300010049 Bacteria 4915
15 Ga0123356_10964816 3300010049 Bacteria 1023
16 Ga0123356_13840318 3300010049 Bacteria 519
17 Ga0123353_10044389 3300010167 Bacteria 7046
18 Ga0123354_10468689 3300010882 Unclassified 1005
19 Ga0466733_019413 3300042659 Bacteria 11692
20 JGI24698J34947_10019875 3300002449 Bacteria 3619
21 JGI24702J35022_10642146 3300002462 Bacteria 658
22 Ga0072940_1010565 3300005200 Unclassified 4951
23 Ga0072941_1000283 3300005201 Unclassified 53040
24 Ga0072941_1009252 3300005201 Bacteria 28581
25 Ga0466710_239932 3300042613 Bacteria 1849
26 Ga0466710_341217 3300042613 Bacteria 1936
27 Ga0466718_020474 3300042617 Bacteria 9635
28 Ga0466718_027213 3300042617 Bacteria 5186
29 Ga0264413_106288 3300024493 Bacteria 30068
30 Ga0264413_122730 3300024493 Bacteria 1215
31 Ga0466694_043881 3300042594 Unclassified 4416
32 Ga0466699_104898 3300042597 Bacteria 1025
33 Ga0466699_177171 3300042597 Bacteria 1036
34 Ga0466735_106473 3300042624 Bacteria 6879
35 Ga0466702_163103 3300042635 Bacteria 1820
36 Ga0466704_542125 3300042643 Bacteria 8092
37 Ga0466724_47668 3300042649 Bacteria 1005
38 Ga0123353_13336183 3300010167 Bacteria 511
39 AustNasuHG_c1000371 3300000089 Bacteria 15579
40 AustNasuHG_c1002733 3300000089 Bacteria 6363
41 AustNasuHG_c1016130 3300000089 Bacteria 2505
42 JGI24698J34947_10115736 3300002449 Unclassified 1174
43 JGI24695J34938_10024844 3300002450 Bacteria 2873
44 Ga0072940_1005379 3300005200 Bacteria 5818
45 Ga0466701_054311 3300042598 Bacteria 18356
46 Ga0466717_289917 3300042604 Bacteria 2239
47 Ga0466721_120179 3300042608 Bacteria 8532
48 Ga0466712_009659 3300042614 Unclassified 12789
49 Ga0264413_100462 3300024493 Bacteria 23940
50 Ga0264413_106289 3300024493 Bacteria 11249
51 Ga0415639_207511 3300038395 Bacteria 3149
52 Ga0466657_066101 3300042582 Bacteria 2880
53 Ga0466694_118480 3300042594 Bacteria 1749
54 Ga0466694_119034 3300042594 Bacteria 8600
55 Ga0466694_158131 3300042594 Bacteria 20194
56 Ga0466699_124353 3300042597 Bacteria 1295
57 Ga0466697_185668 3300042611 Bacteria 9102
58 Ga0466697_199764 3300042611 Bacteria 1639
59 Ga0466697_218610 3300042611 Bacteria 1412
60 Ga0466697_272518 3300042611 Bacteria 1825
61 Ga0466702_325463 3300042635 Bacteria 7974
62 Ga0466703_341980 3300042636 Bacteria 2156
63 Ga0466704_486315 3300042643 Bacteria 11541
64 Ga0123356_10593329 3300010049 Bacteria 1272
65 Ga0123356_11421224 3300010049 Bacteria 854
66 Ga0123356_12660204 3300010049 Bacteria 626
67 Ga0123353_10027885 3300010167 Bacteria 8663
68 Ga0123354_10151511 3300010882 Bacteria 2807
69 Ga0466732_148829 3300042656 Bacteria 1764
70 Ga0466732_218134 3300042656 Bacteria 3353
71 Nasutiter_Contig40690 2030936001 Bacteria 1170
72 JGI24695J34938_10063411 3300002450 Bacteria 1567
73 JGI24696J40584_12961666 3300002834 Bacteria 30668
74 Ga0072940_1005296 3300005200 Bacteria 9151
75 Ga0072940_1066751 3300005200 Unclassified 5074
76 Ga0103267_1000096 3300007190 Bacteria 33753
77 Ga0466701_044531 3300042598 Bacteria 5236
78 Ga0466700_145697 3300042600 Bacteria 1406
79 Ga0466713_056468 3300042602 Bacteria 31687
80 Ga0466720_007470 3300042607 Bacteria 49010
81 Ga0466698_160311 3300042610 Bacteria 3712
82 Ga0466712_071302 3300042614 Bacteria 3957
83 Ga0466712_183453 3300042614 Bacteria 2168
84 Ga0466715_113998 3300042616 Bacteria 1529
85 Ga0466697_214427 3300042611 Bacteria 1001
86 Ga0123356_10564585 3300010049 Bacteria 1300
87 Ga0123356_11512312 3300010049 Bacteria 829
88 Ga0123353_11491512 3300010167 Unclassified 862
89 Ga0123353_12724106 3300010167 Bacteria 581
90 Ga0123353_13006073 3300010167 Bacteria 546
91 Ga0466732_071292 3300042656 Bacteria 4877
92 Ga0466732_344426 3300042656 Bacteria 1099
93 AustNasuHG_c1070438 3300000089 Unclassified 631
94 FAAS_10328237 3300001880 Bacteria 541
95 JGI24698J34947_10002535 3300002449 Unclassified 9851
96 JGI24705J35276_12071945 3300002504 Bacteria 955
97 Ga0072941_1088579 3300005201 Bacteria 5093
98 Ga0466706_265643 3300042599 Bacteria 1065
99 Ga0466707_030502 3300042601 Bacteria 3216
100 Ga0466717_100938 3300042604 Bacteria 2434
101 Ga0466717_172868 3300042604 Bacteria 1628
102 Ga0466720_145975 3300042607 Bacteria 108027
103 Ga0466720_168378 3300042607 Unclassified 2178
104 Ga0466705_434818 3300042612 Bacteria 15423
105 Ga0466710_247943 3300042613 Bacteria 3297
106 Ga0466710_331766 3300042613 Bacteria 3098
107 Ga0466715_326393 3300042616 Bacteria 2064
108 Ga0466718_005487 3300042617 Bacteria 6497
109 Ga0264413_109005 3300024493 Bacteria 16962
110 Ga0466690_176711 3300042590 Bacteria 9194
111 Ga0466694_102254 3300042594 Bacteria 1312
112 Ga0466729_260968 3300042621 Bacteria 30452
113 Ga0123356_10733083 3300010049 Bacteria 1158
114 Ga0123356_10789378 3300010049 Bacteria 1121
115 Ga0123356_11873641 3300010049 Bacteria 746
116 Ga0123353_10066976 3300010167 Bacteria 5766
117 Ga0123353_10128127 3300010167 Bacteria 4076
118 Ga0123353_11760708 3300010167 Bacteria 772
119 Ga0466732_450262 3300042656 Bacteria 7745
120 AustNasuHG_c1017658 3300000089 Bacteria 2369
121 JGI24698J34947_10028281 3300002449 Unclassified 2969
122 JGI24702J35022_10061120 3300002462 Bacteria 2015
123 Ga0072940_1010570 3300005200 Unclassified 4335
124 Ga0072941_1070141 3300005201 Bacteria 6324
125 Ga0103268_1000072 3300007192 Bacteria 31082
126 Ga0466698_358756 3300042610 Bacteria 1523
127 Ga0466712_021744 3300042614 Bacteria 2144
128 Ga0466712_059625 3300042614 Unclassified 14782
129 Ga0466718_062853 3300042617 Bacteria 6129
130 Ga0466718_115277 3300042617 Bacteria 30003
131 Ga0466693_239434 3300042592 Bacteria 1075
132 Ga0466694_115349 3300042594 Bacteria 1440
133 Ga0466694_302079 3300042594 Bacteria 1344
134 Ga0466695_394632 3300042595 Bacteria 1343
135 Ga0466696_219008 3300042596 Bacteria 5713
136 Ga0466699_302213 3300042597 Bacteria 8189
137 Ga0466701_010815 3300042598 Bacteria 22674
138 Ga0466731_366273 3300042622 Bacteria 1066
139 Ga0466731_408936 3300042622 Bacteria 1791
140 Ga0466724_45857 3300042649 Bacteria 3682
141 Ga0123356_12204325 3300010049 Bacteria 689
142 Ga0123353_10000748 3300010167 Bacteria 39416
143 Ga0123353_10012103 3300010167 Bacteria 12226
144 Ga0466732_311567 3300042656 Bacteria 1018
145 IMNBL1DRAFT_c0054279 3300000062 Bacteria 1242
146 AustNasuHG_c1012407 3300000089 Bacteria 2942
147 FAAS_10247631 3300001880 Bacteria 520
148 JGI24698J34947_10001083 3300002449 Unclassified 14037
149 JGI24698J34947_10017658 3300002449 Bacteria 3863
150 JGI24696J40584_12927629 3300002834 Bacteria 1428
151 JGI24696J40584_12933348 3300002834 Bacteria 1519
152 JGI24696J40584_12960603 3300002834 Bacteria 7746
153 Ga0072941_1029460 3300005201 Bacteria 25312
154 Ga0072941_1281685 3300005201 Bacteria 2582
155 Ga0466720_151338 3300042607 Bacteria 52800
156 Ga0466698_109719 3300042610 Bacteria 2242
157 Ga0466710_240933 3300042613 Bacteria 3212
158 Ga0466710_354844 3300042613 Bacteria 1370
159 Ga0466710_411939 3300042613 Bacteria 4496
160 Ga0466710_421611 3300042613 Bacteria 1066
161 Ga0466712_091762 3300042614 Bacteria 20124
162 Ga0466729_135913 3300042621 Bacteria 1149
163 Ga0160433_100033 3300012846 Bacteria 161929
164 Ga0160445_102912 3300012847 Bacteria 3702
165 Ga0466693_209400 3300042592 Bacteria 1386
166 Ga0466694_010572 3300042594 Bacteria 42901
167 Ga0466694_095008 3300042594 Bacteria 4084
168 Ga0466694_146873 3300042594 Bacteria 1219
169 Ga0466724_24671 3300042649 Bacteria 7020
170 Ga0123356_10000992 3300010049 Bacteria 31515
171 Ga0123353_10002201 3300010167 Bacteria 24133
172 Ga0123353_12653025 3300010167 Bacteria 591
173 Ga0123354_10111232 3300010882 Unclassified 3616
174 Ga0123354_10429448 3300010882 Bacteria 1090
175 Ga0123354_10992702 3300010882 Unclassified 541
176 Ga0466732_079013 3300042656 Bacteria 5160
177 Ga0466733_162600 3300042659 Bacteria 32703
178 AustNasuHG_c1023996 3300000089 Unclassified 1939
179 JGI24696J40584_12882192 3300002834 Bacteria 1089
180 Ga0466720_072170 3300042607 Bacteria 36693
181 Ga0466697_035527 3300042611 Bacteria 1457
182 Ga0466710_402223 3300042613 Bacteria 5350
183 Ga0466712_080659 3300042614 Bacteria 7940
184 Ga0466718_132744 3300042617 Bacteria 9480
185 Ga0466726_438612 3300042619 Bacteria 4863
186 Ga0264413_101950 3300024493 Bacteria 14301
187 Ga0466694_261363 3300042594 Bacteria 13867
188 Ga0466699_023934 3300042597 Unclassified 6385
189 Ga0466699_035963 3300042597 Unclassified 3045
190 Ga0466701_008798 3300042598 Bacteria 2824
191 Ga0466697_280078 3300042611 Unclassified 5947
192 Ga0466731_013508 3300042622 Bacteria 24867
193 Ga0466731_031578 3300042622 Bacteria 16341
194 Ga0466731_377907 3300042622 Bacteria 1138
195 Ga0466734_119759 3300042623 Bacteria 1556
196 Ga0466724_28849 3300042649 Bacteria 1472

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_421611 Ga0466710_421611_192_539 105
2 3300001880 FAAS_10328237 FAAS_103282371 106
3 3300001880 FAAS_10247631 FAAS_102476311 113
4 3300042610 Ga0466698_358756 Ga0466698_358756_139_483 114
5 3300042616 Ga0466715_113998 Ga0466715_113998_1137_1481 114
6 3300042616 Ga0466715_326393 Ga0466715_326393_313_657 114
7 3300042621 Ga0466729_135913 Ga0466729_135913_280_624 114
8 3300042624 Ga0466735_106473 Ga0466735_106473_3359_3703 114
9 3300042636 Ga0466703_341980 Ga0466703_341980_266_610 114
10 3300042643 Ga0466704_486315 Ga0466704_486315_7345_7689 114
11 3300042656 Ga0466732_311567 Ga0466732_311567_247_591 114
12 3300042659 Ga0466733_162600 Ga0466733_162600_7051_7395 114
13 3300000062 IMNBL1DRAFT_c0054279 IMNBL1DRAFT_00542792 115
14 3300002504 JGI24705J35276_12071945 JGI24705J35276_120719452 115
15 3300005083 Ga0068305_10007762 Ga0068305_1000776242 115
16 3300010167 Ga0123353_10002201 Ga0123353_1000220115 115
17 3300042582 Ga0466657_349192 Ga0466657_349192_542_889 115
18 3300042592 Ga0466693_209400 Ga0466693_209400_988_1335 115
19 3300042592 Ga0466693_239434 Ga0466693_239434_613_960 115
20 3300042594 Ga0466694_095008 Ga0466694_095008_2852_3199 115
21 3300042594 Ga0466694_115349 Ga0466694_115349_211_558 115
22 3300042594 Ga0466694_146873 Ga0466694_146873_740_1087 115
23 3300042594 Ga0466694_261363 Ga0466694_261363_1038_1385 115
24 3300042595 Ga0466695_394632 Ga0466695_394632_596_943 115
25 3300042597 Ga0466699_124353 Ga0466699_124353_863_1210 115
26 3300042598 Ga0466701_008798 Ga0466701_008798_2326_2673 115
27 3300042598 Ga0466701_010815 Ga0466701_010815_5849_6196 115
28 3300042598 Ga0466701_044531 Ga0466701_044531_1959_2306 115
29 3300042598 Ga0466701_054311 Ga0466701_054311_11036_11383 115
30 3300042599 Ga0466706_265643 Ga0466706_265643_16_363 115
31 3300042600 Ga0466700_145697 Ga0466700_145697_657_1004 115
32 3300042604 Ga0466717_100938 Ga0466717_100938_133_480 115
33 3300042607 Ga0466720_168378 Ga0466720_168378_1708_2055 115
34 3300042608 Ga0466721_120179 Ga0466721_120179_5473_5820 115
35 3300042610 Ga0466698_160311 Ga0466698_160311_560_907 115
36 3300042611 Ga0466697_035527 Ga0466697_035527_520_867 115
37 3300042611 Ga0466697_185668 Ga0466697_185668_7344_7691 115
38 3300042611 Ga0466697_218610 Ga0466697_218610_423_770 115
39 3300042611 Ga0466697_272518 Ga0466697_272518_724_1071 115
40 3300042611 Ga0466697_280078 Ga0466697_280078_3219_3566 115
41 3300042613 Ga0466710_239932 Ga0466710_239932_585_932 115
42 3300042613 Ga0466710_240933 Ga0466710_240933_1986_2333 115
43 3300042613 Ga0466710_247943 Ga0466710_247943_720_1067 115
44 3300042613 Ga0466710_331766 Ga0466710_331766_2452_2799 115
45 3300042613 Ga0466710_341217 Ga0466710_341217_148_495 115
46 3300042613 Ga0466710_402223 Ga0466710_402223_3663_4010 115
47 3300042613 Ga0466710_411939 Ga0466710_411939_2141_2488 115
48 3300042614 Ga0466712_021744 Ga0466712_021744_1343_1690 115
49 3300042621 Ga0466729_260968 Ga0466729_260968_15047_15394 115
50 3300042622 Ga0466731_013508 Ga0466731_013508_20289_20636 115
51 3300042622 Ga0466731_366273 Ga0466731_366273_305_652 115
52 3300042622 Ga0466731_408936 Ga0466731_408936_1149_1496 115
53 3300042649 Ga0466724_24671 Ga0466724_24671_4016_4363 115
54 3300042649 Ga0466724_28849 Ga0466724_28849_1077_1424 115
55 3300042656 Ga0466732_071292 Ga0466732_071292_791_1138 115
56 3300042656 Ga0466732_148829 Ga0466732_148829_667_1014 115
57 3300042656 Ga0466732_218134 Ga0466732_218134_164_511 115
58 iso_pr_bacteria 2820753519 2820755108 115
59 iso_pr_bacteria 2820755292 2820756389 115
60 iso_pr_bacteria 2820783511 2820783689 115
61 iso_pr_bacteria 2820792843 2820794356 115
62 iso_pr_bacteria 2820795054 2820795928 115
63 iso_pr_bacteria 2820797595 2820797940 115
64 3300002449 JGI24698J34947_10115736 JGI24698J34947_101157362 116
65 3300002462 JGI24702J35022_10061120 JGI24702J35022_100611202 116
66 3300002462 JGI24702J35022_10642146 JGI24702J35022_106421461 116
67 3300002834 JGI24696J40584_12927629 JGI24696J40584_129276292 116
68 3300002834 JGI24696J40584_12933348 JGI24696J40584_129333482 116
69 3300002834 JGI24696J40584_12960603 JGI24696J40584_129606036 116
70 3300002834 JGI24696J40584_12961666 JGI24696J40584_1296166620 116
71 3300005201 Ga0072941_1151975 Ga0072941_11519753 116
72 3300005201 Ga0072941_1281685 Ga0072941_12816852 116
73 3300010049 Ga0123356_10000992 Ga0123356_100009923 116
74 3300010049 Ga0123356_10032105 Ga0123356_100321053 116
75 3300010049 Ga0123356_10038349 Ga0123356_100383493 116
76 3300010049 Ga0123356_10063096 Ga0123356_100630962 116
77 3300010049 Ga0123356_10073423 Ga0123356_100734232 116
78 3300010049 Ga0123356_10564585 Ga0123356_105645852 116
79 3300010049 Ga0123356_10593329 Ga0123356_105933292 116
80 3300010049 Ga0123356_11512312 Ga0123356_115123122 116
81 3300010049 Ga0123356_11873641 Ga0123356_118736412 116
82 3300010049 Ga0123356_12204325 Ga0123356_122043252 116
83 3300010049 Ga0123356_13840318 Ga0123356_138403181 116
84 3300010167 Ga0123353_10000748 Ga0123353_1000074814 116
85 3300010167 Ga0123353_10012103 Ga0123353_1001210310 116
86 3300010167 Ga0123353_10027885 Ga0123353_100278858 116
87 3300010167 Ga0123353_10044389 Ga0123353_100443894 116
88 3300010167 Ga0123353_10719248 Ga0123353_107192482 116
89 3300010167 Ga0123353_11491512 Ga0123353_114915121 116
90 3300010167 Ga0123353_11760708 Ga0123353_117607082 116
91 3300010167 Ga0123353_12724106 Ga0123353_127241061 116
92 3300010882 Ga0123354_10111232 Ga0123354_101112324 116
93 3300010882 Ga0123354_10151511 Ga0123354_101515112 116
94 3300010882 Ga0123354_10429448 Ga0123354_104294481 116
95 3300010882 Ga0123354_10468689 Ga0123354_104686892 116
96 3300010882 Ga0123354_10992702 Ga0123354_109927021 116
97 3300042582 Ga0466657_066101 Ga0466657_066101_2492_2842 116
98 3300042594 Ga0466694_118480 Ga0466694_118480_526_876 116
99 3300042596 Ga0466696_219008 Ga0466696_219008_2924_3274 116
100 3300042601 Ga0466707_030502 Ga0466707_030502_21_371 116
101 3300042602 Ga0466713_056468 Ga0466713_056468_23036_23386 116
102 3300042604 Ga0466717_289917 Ga0466717_289917_1497_1847 116
103 3300042611 Ga0466697_199764 Ga0466697_199764_258_608 116
104 3300042611 Ga0466697_214427 Ga0466697_214427_221_571 116
105 3300042613 Ga0466710_354844 Ga0466710_354844_842_1192 116
106 3300042622 Ga0466731_377907 Ga0466731_377907_306_656 116
107 3300042623 Ga0466734_119759 Ga0466734_119759_897_1247 116
108 3300042649 Ga0466724_47668 Ga0466724_47668_578_928 116
109 3300042659 Ga0466733_019413 Ga0466733_019413_806_1156 116
110 3300007190 Ga0103267_1000096 Ga0103267_100009628 117
111 3300007192 Ga0103268_1000072 Ga0103268_100007229 117
112 3300010049 Ga0123356_10733083 Ga0123356_107330832 117
113 3300010049 Ga0123356_10964816 Ga0123356_109648162 117
114 3300010049 Ga0123356_11421224 Ga0123356_114212242 117
115 3300010167 Ga0123353_10066976 Ga0123353_100669764 117
116 3300010167 Ga0123353_11196049 Ga0123353_111960492 117
117 3300010167 Ga0123353_12653025 Ga0123353_126530251 117
118 3300010167 Ga0123353_13336183 Ga0123353_133361832 117
119 3300024493 Ga0264413_106288 Ga0264413_10628822 117
120 3300042601 Ga0466707_178168 Ga0466707_178168_2423_2776 117
121 3300042612 Ga0466705_434818 Ga0466705_434818_6964_7317 117
122 3300042619 Ga0466726_438612 Ga0466726_438612_1321_1674 117
123 3300042643 Ga0466704_542125 Ga0466704_542125_5487_5840 117
124 3300000089 AustNasuHG_c1012407 AustNasuHG_10124072 118
125 3300000089 AustNasuHG_c1023996 AustNasuHG_10239962 118
126 3300002450 JGI24695J34938_10063411 JGI24695J34938_100634112 118
127 3300010049 Ga0123356_12660204 Ga0123356_126602041 118
128 3300024493 Ga0264413_122730 Ga0264413_1227301 118
129 3300042590 Ga0466690_176711 Ga0466690_176711_4214_4570 118
130 3300042597 Ga0466699_023934 Ga0466699_023934_5527_5883 118
131 3300042597 Ga0466699_035963 Ga0466699_035963_2381_2737 118
132 3300042597 Ga0466699_104898 Ga0466699_104898_264_620 118
133 3300042597 Ga0466699_177171 Ga0466699_177171_617_973 118
134 3300042597 Ga0466699_302213 Ga0466699_302213_5054_5410 118
135 3300042604 Ga0466717_172868 Ga0466717_172868_219_575 118
136 3300042616 Ga0466715_499349 Ga0466715_499349_6932_7288 118
137 3300042617 Ga0466718_005487 Ga0466718_005487_4476_4832 118
138 3300042617 Ga0466718_115277 Ga0466718_115277_28854_29210 118
139 3300042635 Ga0466702_163103 Ga0466702_163103_357_713 118
140 3300042635 Ga0466702_325463 Ga0466702_325463_1502_1858 118
141 3300042656 Ga0466732_344426 Ga0466732_344426_447_803 118
142 3300000089 AustNasuHG_c1016130 AustNasuHG_10161302 119
143 3300002834 JGI24696J40584_12882192 JGI24696J40584_128821922 119
144 3300005200 Ga0072940_1005296 Ga0072940_10052963 119
145 3300005200 Ga0072940_1010570 Ga0072940_10105702 119
146 3300010167 Ga0123353_13006073 Ga0123353_130060731 119
147 3300012846 Ga0160433_100033 Ga0160433_1000337 119
148 3300012847 Ga0160445_102912 Ga0160445_1029123 119
149 3300024493 Ga0264413_100462 Ga0264413_10046217 119
150 3300024493 Ga0264413_106289 Ga0264413_1062899 119
151 3300024493 Ga0264413_109005 Ga0264413_10900513 119
152 3300042594 Ga0466694_119034 Ga0466694_119034_3876_4235 119
153 3300042607 Ga0466720_072170 Ga0466720_072170_11243_11602 119
154 3300042607 Ga0466720_145975 Ga0466720_145975_40898_41257 119
155 3300042607 Ga0466720_151338 Ga0466720_151338_31017_31376 119
156 3300042610 Ga0466698_109719 Ga0466698_109719_1373_1732 119
157 3300042614 Ga0466712_071302 Ga0466712_071302_1162_1521 119
158 3300042614 Ga0466712_080659 Ga0466712_080659_5558_5917 119
159 3300042617 Ga0466718_027213 Ga0466718_027213_2557_2916 119
160 3300042617 Ga0466718_062853 Ga0466718_062853_4858_5217 119
161 3300042656 Ga0466732_079013 Ga0466732_079013_2963_3322 119
162 iso_pr_bacteria 2740892546 2743912233 119
163 iso_pr_bacteria 2773857779 2774479299 119
164 iso_pr_bacteria 2820716747 2820718638 119
165 2030936001 Nasutiter_Contig40690 Nasutiterm_109510 120
166 3300000089 AustNasuHG_c1017658 AustNasuHG_10176582 120
167 3300000089 AustNasuHG_c1070438 AustNasuHG_10704381 120
168 3300002449 JGI24698J34947_10002535 JGI24698J34947_100025357 120
169 3300002450 JGI24695J34938_10024844 JGI24695J34938_100248442 120
170 3300005200 Ga0072940_1010565 Ga0072940_10105654 120
171 3300005201 Ga0072941_1009252 Ga0072941_100925218 120
172 3300005201 Ga0072941_1070141 Ga0072941_10701414 120
173 3300005485 Ga0074263_105271 Ga0074263_1052712 120
174 3300024493 Ga0264413_101950 Ga0264413_10195012 120
175 3300042594 Ga0466694_043881 Ga0466694_043881_1395_1757 120
176 3300042607 Ga0466720_007470 Ga0466720_007470_45288_45650 120
177 3300042614 Ga0466712_009659 Ga0466712_009659_6905_7267 120
178 3300042614 Ga0466712_091762 Ga0466712_091762_11864_12226 120
179 3300042614 Ga0466712_183453 Ga0466712_183453_1302_1664 120
180 iso_pr_bacteria 2740892545 2743907789 120
181 3300002449 JGI24698J34947_10001083 JGI24698J34947_100010839 121
182 3300002449 JGI24698J34947_10004703 JGI24698J34947_100047037 121
183 3300002449 JGI24698J34947_10017658 JGI24698J34947_100176582 121
184 3300002507 JGI24697J35500_11194260 JGI24697J35500_111942602 121
185 3300005201 Ga0072941_1000283 Ga0072941_100028348 121
186 3300005201 Ga0072941_1029460 Ga0072941_102946021 121
187 3300005201 Ga0072941_1088579 Ga0072941_10885794 121
188 3300042594 Ga0466694_010572 Ga0466694_010572_34291_34656 121
189 3300042594 Ga0466694_158131 Ga0466694_158131_7136_7501 121
190 3300042594 Ga0466694_302079 Ga0466694_302079_483_848 121
191 3300042617 Ga0466718_020474 Ga0466718_020474_4236_4601 121
192 3300042617 Ga0466718_132744 Ga0466718_132744_4231_4596 121
193 3300042622 Ga0466731_031578 Ga0466731_031578_5783_6148 121
194 3300042656 Ga0466732_450262 Ga0466732_450262_3323_3688 121
195 iso_pr_bacteria 2820714932 2820716625 121
196 3300000089 AustNasuHG_c1000371 AustNasuHG_10003719 122
197 3300000089 AustNasuHG_c1002733 AustNasuHG_10027336 122
198 3300005200 Ga0072940_1005379 Ga0072940_10053791 122
199 3300005200 Ga0072940_1066751 Ga0072940_10667513 122
200 3300042594 Ga0466694_102254 Ga0466694_102254_200_571 123
201 3300010049 Ga0123356_10789378 Ga0123356_107893781 124
202 3300042614 Ga0466712_059625 Ga0466712_059625_10303_10680 125
203 3300042649 Ga0466724_45857 Ga0466724_45857_226_603 125
204 3300002449 JGI24698J34947_10019875 JGI24698J34947_100198751 126
205 3300002449 JGI24698J34947_10028281 JGI24698J34947_100282811 126
206 3300010167 Ga0123353_10128127 Ga0123353_101281275 126
207 3300038395 Ga0415639_207511 Ga0415639_207511_1591_1983 130

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02261 Asp_decarbox Aspartate decarboxylase 1 115 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.