Protein Family IF00003
Metagenome
Isolate
207
Members
67
Samples
196
Scaffolds
117.29
Avg Length
Representative Sequence
- ID
- 2030936001|Nasutiter_Contig40690|Nasutiterm_109510
- Length
- 120 aa
- Sequence
- MLVELLKSKIHRATVTDACLDYEGSITIDKRAYAGGWGFFEHEKVHVLNLNNGERFETYVIEGKSKSGTVCLNGAAARLVQKNDLVIIAAYVSLTPQEAKSWQPRVVKVNAKNKIIDSKK
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.7%
Unclassified
21.9%
Kalotermitidae
9.4%
Formicidae
3.1%
Armadillidiidae
3.1%
Termopsidae
3.1%
Rhinotermitidae
1.6%
Hodotermitidae
1.6%
Passalidae
1.6%
Taxonomy
Archaea
0
Bacteria
184
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 12 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 13 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 21 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 26 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 27 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 33 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 43 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 44 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 50 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 54 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 57 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 58 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 59 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 60 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 61 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 63 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 64 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 65 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 66 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 67 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_019413 | 3300042659 | Bacteria | 11692 |
| 2 | Ga0123356_10032105 | 3300010049 | Bacteria | 4915 |
| 3 | Ga0123356_10964816 | 3300010049 | Bacteria | 1023 |
| 4 | Ga0123356_13840318 | 3300010049 | Bacteria | 519 |
| 5 | Ga0123353_10044389 | 3300010167 | Bacteria | 7046 |
| 6 | Ga0123354_10468689 | 3300010882 | Unclassified | 1005 |
| 7 | Ga0466710_239932 | 3300042613 | Bacteria | 1849 |
| 8 | Ga0466710_341217 | 3300042613 | Bacteria | 1936 |
| 9 | Ga0466718_020474 | 3300042617 | Bacteria | 9635 |
| 10 | Ga0466718_027213 | 3300042617 | Bacteria | 5186 |
| 11 | Ga0264413_106288 | 3300024493 | Bacteria | 30068 |
| 12 | Ga0264413_122730 | 3300024493 | Bacteria | 1215 |
| 13 | Ga0466694_043881 | 3300042594 | Unclassified | 4416 |
| 14 | Ga0466699_104898 | 3300042597 | Bacteria | 1025 |
| 15 | Ga0466699_177171 | 3300042597 | Bacteria | 1036 |
| 16 | Ga0466735_106473 | 3300042624 | Bacteria | 6879 |
| 17 | Ga0466702_163103 | 3300042635 | Bacteria | 1820 |
| 18 | Ga0466704_542125 | 3300042643 | Bacteria | 8092 |
| 19 | Ga0466724_47668 | 3300042649 | Bacteria | 1005 |
| 20 | JGI24698J34947_10019875 | 3300002449 | Bacteria | 3619 |
| 21 | JGI24702J35022_10642146 | 3300002462 | Bacteria | 658 |
| 22 | Ga0072940_1010565 | 3300005200 | Unclassified | 4951 |
| 23 | Ga0072941_1000283 | 3300005201 | Unclassified | 53040 |
| 24 | Ga0072941_1009252 | 3300005201 | Bacteria | 28581 |
| 25 | Ga0466732_450262 | 3300042656 | Bacteria | 7745 |
| 26 | Ga0123356_10733083 | 3300010049 | Bacteria | 1158 |
| 27 | Ga0123356_10789378 | 3300010049 | Bacteria | 1121 |
| 28 | Ga0123356_11873641 | 3300010049 | Bacteria | 746 |
| 29 | Ga0123353_10066976 | 3300010167 | Bacteria | 5766 |
| 30 | Ga0123353_10128127 | 3300010167 | Bacteria | 4076 |
| 31 | Ga0123353_11760708 | 3300010167 | Bacteria | 772 |
| 32 | Ga0466712_021744 | 3300042614 | Bacteria | 2144 |
| 33 | Ga0466712_059625 | 3300042614 | Unclassified | 14782 |
| 34 | Ga0466718_062853 | 3300042617 | Bacteria | 6129 |
| 35 | Ga0466718_115277 | 3300042617 | Bacteria | 30003 |
| 36 | Ga0466693_239434 | 3300042592 | Bacteria | 1075 |
| 37 | Ga0466694_115349 | 3300042594 | Bacteria | 1440 |
| 38 | Ga0466694_302079 | 3300042594 | Bacteria | 1344 |
| 39 | Ga0466695_394632 | 3300042595 | Bacteria | 1343 |
| 40 | Ga0466696_219008 | 3300042596 | Bacteria | 5713 |
| 41 | Ga0466699_302213 | 3300042597 | Bacteria | 8189 |
| 42 | Ga0466701_010815 | 3300042598 | Bacteria | 22674 |
| 43 | Ga0466731_366273 | 3300042622 | Bacteria | 1066 |
| 44 | Ga0466731_408936 | 3300042622 | Bacteria | 1791 |
| 45 | Ga0466724_45857 | 3300042649 | Bacteria | 3682 |
| 46 | Ga0466698_358756 | 3300042610 | Bacteria | 1523 |
| 47 | AustNasuHG_c1017658 | 3300000089 | Bacteria | 2369 |
| 48 | JGI24698J34947_10028281 | 3300002449 | Unclassified | 2969 |
| 49 | JGI24702J35022_10061120 | 3300002462 | Bacteria | 2015 |
| 50 | Ga0072940_1010570 | 3300005200 | Unclassified | 4335 |
| 51 | Ga0072941_1070141 | 3300005201 | Bacteria | 6324 |
| 52 | Ga0103268_1000072 | 3300007192 | Bacteria | 31082 |
| 53 | Ga0466697_280078 | 3300042611 | Unclassified | 5947 |
| 54 | Ga0466732_079013 | 3300042656 | Bacteria | 5160 |
| 55 | Ga0466733_162600 | 3300042659 | Bacteria | 32703 |
| 56 | Ga0123356_10000992 | 3300010049 | Bacteria | 31515 |
| 57 | Ga0123353_10002201 | 3300010167 | Bacteria | 24133 |
| 58 | Ga0123353_12653025 | 3300010167 | Bacteria | 591 |
| 59 | Ga0123354_10111232 | 3300010882 | Unclassified | 3616 |
| 60 | Ga0123354_10429448 | 3300010882 | Bacteria | 1090 |
| 61 | Ga0123354_10992702 | 3300010882 | Unclassified | 541 |
| 62 | Ga0466710_402223 | 3300042613 | Bacteria | 5350 |
| 63 | Ga0466712_080659 | 3300042614 | Bacteria | 7940 |
| 64 | Ga0466718_132744 | 3300042617 | Bacteria | 9480 |
| 65 | Ga0466726_438612 | 3300042619 | Bacteria | 4863 |
| 66 | Ga0264413_101950 | 3300024493 | Bacteria | 14301 |
| 67 | Ga0466694_261363 | 3300042594 | Bacteria | 13867 |
| 68 | Ga0466699_023934 | 3300042597 | Unclassified | 6385 |
| 69 | Ga0466699_035963 | 3300042597 | Unclassified | 3045 |
| 70 | Ga0466701_008798 | 3300042598 | Bacteria | 2824 |
| 71 | Ga0466731_013508 | 3300042622 | Bacteria | 24867 |
| 72 | Ga0466731_031578 | 3300042622 | Bacteria | 16341 |
| 73 | Ga0466731_377907 | 3300042622 | Bacteria | 1138 |
| 74 | Ga0466734_119759 | 3300042623 | Bacteria | 1556 |
| 75 | Ga0466724_28849 | 3300042649 | Bacteria | 1472 |
| 76 | Ga0466720_072170 | 3300042607 | Bacteria | 36693 |
| 77 | Ga0466697_035527 | 3300042611 | Bacteria | 1457 |
| 78 | AustNasuHG_c1023996 | 3300000089 | Unclassified | 1939 |
| 79 | JGI24696J40584_12882192 | 3300002834 | Bacteria | 1089 |
| 80 | Ga0466732_071292 | 3300042656 | Bacteria | 4877 |
| 81 | Ga0466732_344426 | 3300042656 | Bacteria | 1099 |
| 82 | Ga0123356_10564585 | 3300010049 | Bacteria | 1300 |
| 83 | Ga0123356_11512312 | 3300010049 | Bacteria | 829 |
| 84 | Ga0123353_11491512 | 3300010167 | Unclassified | 862 |
| 85 | Ga0123353_12724106 | 3300010167 | Bacteria | 581 |
| 86 | Ga0123353_13006073 | 3300010167 | Bacteria | 546 |
| 87 | Ga0466705_434818 | 3300042612 | Bacteria | 15423 |
| 88 | Ga0466710_247943 | 3300042613 | Bacteria | 3297 |
| 89 | Ga0466710_331766 | 3300042613 | Bacteria | 3098 |
| 90 | Ga0466715_326393 | 3300042616 | Bacteria | 2064 |
| 91 | Ga0466718_005487 | 3300042617 | Bacteria | 6497 |
| 92 | Ga0264413_109005 | 3300024493 | Bacteria | 16962 |
| 93 | Ga0466690_176711 | 3300042590 | Bacteria | 9194 |
| 94 | Ga0466694_102254 | 3300042594 | Bacteria | 1312 |
| 95 | Ga0466729_260968 | 3300042621 | Bacteria | 30452 |
| 96 | Ga0466706_265643 | 3300042599 | Bacteria | 1065 |
| 97 | Ga0466707_030502 | 3300042601 | Bacteria | 3216 |
| 98 | Ga0466717_100938 | 3300042604 | Bacteria | 2434 |
| 99 | Ga0466717_172868 | 3300042604 | Bacteria | 1628 |
| 100 | Ga0466720_145975 | 3300042607 | Bacteria | 108027 |
| 101 | Ga0466720_168378 | 3300042607 | Unclassified | 2178 |
| 102 | AustNasuHG_c1070438 | 3300000089 | Unclassified | 631 |
| 103 | FAAS_10328237 | 3300001880 | Bacteria | 541 |
| 104 | JGI24698J34947_10002535 | 3300002449 | Unclassified | 9851 |
| 105 | JGI24705J35276_12071945 | 3300002504 | Bacteria | 955 |
| 106 | Ga0072941_1088579 | 3300005201 | Bacteria | 5093 |
| 107 | Ga0466697_185668 | 3300042611 | Bacteria | 9102 |
| 108 | Ga0466697_199764 | 3300042611 | Bacteria | 1639 |
| 109 | Ga0466697_218610 | 3300042611 | Bacteria | 1412 |
| 110 | Ga0466697_272518 | 3300042611 | Bacteria | 1825 |
| 111 | Ga0123353_13336183 | 3300010167 | Bacteria | 511 |
| 112 | Ga0466712_009659 | 3300042614 | Unclassified | 12789 |
| 113 | Ga0264413_100462 | 3300024493 | Bacteria | 23940 |
| 114 | Ga0264413_106289 | 3300024493 | Bacteria | 11249 |
| 115 | Ga0415639_207511 | 3300038395 | Bacteria | 3149 |
| 116 | Ga0466657_066101 | 3300042582 | Bacteria | 2880 |
| 117 | Ga0466694_118480 | 3300042594 | Bacteria | 1749 |
| 118 | Ga0466694_119034 | 3300042594 | Bacteria | 8600 |
| 119 | Ga0466694_158131 | 3300042594 | Bacteria | 20194 |
| 120 | Ga0466699_124353 | 3300042597 | Bacteria | 1295 |
| 121 | Ga0466702_325463 | 3300042635 | Bacteria | 7974 |
| 122 | Ga0466703_341980 | 3300042636 | Bacteria | 2156 |
| 123 | Ga0466704_486315 | 3300042643 | Bacteria | 11541 |
| 124 | Ga0466701_054311 | 3300042598 | Bacteria | 18356 |
| 125 | Ga0466717_289917 | 3300042604 | Bacteria | 2239 |
| 126 | Ga0466721_120179 | 3300042608 | Bacteria | 8532 |
| 127 | AustNasuHG_c1000371 | 3300000089 | Bacteria | 15579 |
| 128 | AustNasuHG_c1002733 | 3300000089 | Bacteria | 6363 |
| 129 | AustNasuHG_c1016130 | 3300000089 | Bacteria | 2505 |
| 130 | JGI24698J34947_10115736 | 3300002449 | Unclassified | 1174 |
| 131 | JGI24695J34938_10024844 | 3300002450 | Bacteria | 2873 |
| 132 | Ga0072940_1005379 | 3300005200 | Bacteria | 5818 |
| 133 | Ga0123356_10038349 | 3300010049 | Bacteria | 4465 |
| 134 | Ga0123356_10063096 | 3300010049 | Bacteria | 3462 |
| 135 | Ga0123356_10073423 | 3300010049 | Unclassified | 3217 |
| 136 | Ga0123353_10719248 | 3300010167 | Bacteria | 1397 |
| 137 | Ga0123353_11196049 | 3300010167 | Bacteria | 998 |
| 138 | Ga0466715_499349 | 3300042616 | Bacteria | 11319 |
| 139 | Ga0466657_349192 | 3300042582 | Bacteria | 3430 |
| 140 | Ga0466707_178168 | 3300042601 | Bacteria | 3566 |
| 141 | JGI24698J34947_10004703 | 3300002449 | Bacteria | 7453 |
| 142 | JGI24697J35500_11194260 | 3300002507 | Unclassified | 1613 |
| 143 | Ga0068305_10007762 | 3300005083 | Bacteria | 82937 |
| 144 | Ga0072941_1151975 | 3300005201 | Bacteria | 9512 |
| 145 | Ga0074263_105271 | 3300005485 | Bacteria | 1585 |
| 146 | Ga0466697_214427 | 3300042611 | Bacteria | 1001 |
| 147 | Ga0466732_148829 | 3300042656 | Bacteria | 1764 |
| 148 | Ga0466732_218134 | 3300042656 | Bacteria | 3353 |
| 149 | Ga0123356_10593329 | 3300010049 | Bacteria | 1272 |
| 150 | Ga0123356_11421224 | 3300010049 | Bacteria | 854 |
| 151 | Ga0123356_12660204 | 3300010049 | Bacteria | 626 |
| 152 | Ga0123353_10027885 | 3300010167 | Bacteria | 8663 |
| 153 | Ga0123354_10151511 | 3300010882 | Bacteria | 2807 |
| 154 | Ga0466712_071302 | 3300042614 | Bacteria | 3957 |
| 155 | Ga0466712_183453 | 3300042614 | Bacteria | 2168 |
| 156 | Ga0466715_113998 | 3300042616 | Bacteria | 1529 |
| 157 | Ga0466701_044531 | 3300042598 | Bacteria | 5236 |
| 158 | Ga0466700_145697 | 3300042600 | Bacteria | 1406 |
| 159 | Ga0466713_056468 | 3300042602 | Bacteria | 31687 |
| 160 | Ga0466720_007470 | 3300042607 | Bacteria | 49010 |
| 161 | Ga0466698_160311 | 3300042610 | Bacteria | 3712 |
| 162 | Nasutiter_Contig40690 | 2030936001 | Bacteria | 1170 |
| 163 | JGI24695J34938_10063411 | 3300002450 | Bacteria | 1567 |
| 164 | JGI24696J40584_12961666 | 3300002834 | Bacteria | 30668 |
| 165 | Ga0072940_1005296 | 3300005200 | Bacteria | 9151 |
| 166 | Ga0072940_1066751 | 3300005200 | Unclassified | 5074 |
| 167 | Ga0103267_1000096 | 3300007190 | Bacteria | 33753 |
| 168 | Ga0466732_311567 | 3300042656 | Bacteria | 1018 |
| 169 | Ga0123356_12204325 | 3300010049 | Bacteria | 689 |
| 170 | Ga0123353_10000748 | 3300010167 | Bacteria | 39416 |
| 171 | Ga0123353_10012103 | 3300010167 | Bacteria | 12226 |
| 172 | Ga0466710_240933 | 3300042613 | Bacteria | 3212 |
| 173 | Ga0466710_354844 | 3300042613 | Bacteria | 1370 |
| 174 | Ga0466710_411939 | 3300042613 | Bacteria | 4496 |
| 175 | Ga0466710_421611 | 3300042613 | Bacteria | 1066 |
| 176 | Ga0466712_091762 | 3300042614 | Bacteria | 20124 |
| 177 | Ga0466729_135913 | 3300042621 | Bacteria | 1149 |
| 178 | Ga0160433_100033 | 3300012846 | Bacteria | 161929 |
| 179 | Ga0160445_102912 | 3300012847 | Bacteria | 3702 |
| 180 | Ga0466693_209400 | 3300042592 | Bacteria | 1386 |
| 181 | Ga0466694_010572 | 3300042594 | Bacteria | 42901 |
| 182 | Ga0466694_095008 | 3300042594 | Bacteria | 4084 |
| 183 | Ga0466694_146873 | 3300042594 | Bacteria | 1219 |
| 184 | Ga0466724_24671 | 3300042649 | Bacteria | 7020 |
| 185 | Ga0466720_151338 | 3300042607 | Bacteria | 52800 |
| 186 | Ga0466698_109719 | 3300042610 | Bacteria | 2242 |
| 187 | IMNBL1DRAFT_c0054279 | 3300000062 | Bacteria | 1242 |
| 188 | AustNasuHG_c1012407 | 3300000089 | Bacteria | 2942 |
| 189 | FAAS_10247631 | 3300001880 | Bacteria | 520 |
| 190 | JGI24698J34947_10001083 | 3300002449 | Unclassified | 14037 |
| 191 | JGI24698J34947_10017658 | 3300002449 | Bacteria | 3863 |
| 192 | JGI24696J40584_12927629 | 3300002834 | Bacteria | 1428 |
| 193 | JGI24696J40584_12933348 | 3300002834 | Bacteria | 1519 |
| 194 | JGI24696J40584_12960603 | 3300002834 | Bacteria | 7746 |
| 195 | Ga0072941_1029460 | 3300005201 | Bacteria | 25312 |
| 196 | Ga0072941_1281685 | 3300005201 | Bacteria | 2582 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042613 | Ga0466710_421611 | Ga0466710_421611_192_539 | 105 |
| 2 | 3300001880 | FAAS_10328237 | FAAS_103282371 | 106 |
| 3 | 3300001880 | FAAS_10247631 | FAAS_102476311 | 113 |
| 4 | 3300042610 | Ga0466698_358756 | Ga0466698_358756_139_483 | 114 |
| 5 | 3300042616 | Ga0466715_113998 | Ga0466715_113998_1137_1481 | 114 |
| 6 | 3300042616 | Ga0466715_326393 | Ga0466715_326393_313_657 | 114 |
| 7 | 3300042621 | Ga0466729_135913 | Ga0466729_135913_280_624 | 114 |
| 8 | 3300042624 | Ga0466735_106473 | Ga0466735_106473_3359_3703 | 114 |
| 9 | 3300042636 | Ga0466703_341980 | Ga0466703_341980_266_610 | 114 |
| 10 | 3300042643 | Ga0466704_486315 | Ga0466704_486315_7345_7689 | 114 |
| 11 | 3300042656 | Ga0466732_311567 | Ga0466732_311567_247_591 | 114 |
| 12 | 3300042659 | Ga0466733_162600 | Ga0466733_162600_7051_7395 | 114 |
| 13 | 3300000062 | IMNBL1DRAFT_c0054279 | IMNBL1DRAFT_00542792 | 115 |
| 14 | 3300002504 | JGI24705J35276_12071945 | JGI24705J35276_120719452 | 115 |
| 15 | 3300005083 | Ga0068305_10007762 | Ga0068305_1000776242 | 115 |
| 16 | 3300010167 | Ga0123353_10002201 | Ga0123353_1000220115 | 115 |
| 17 | 3300042582 | Ga0466657_349192 | Ga0466657_349192_542_889 | 115 |
| 18 | 3300042592 | Ga0466693_209400 | Ga0466693_209400_988_1335 | 115 |
| 19 | 3300042592 | Ga0466693_239434 | Ga0466693_239434_613_960 | 115 |
| 20 | 3300042594 | Ga0466694_095008 | Ga0466694_095008_2852_3199 | 115 |
| 21 | 3300042594 | Ga0466694_115349 | Ga0466694_115349_211_558 | 115 |
| 22 | 3300042594 | Ga0466694_146873 | Ga0466694_146873_740_1087 | 115 |
| 23 | 3300042594 | Ga0466694_261363 | Ga0466694_261363_1038_1385 | 115 |
| 24 | 3300042595 | Ga0466695_394632 | Ga0466695_394632_596_943 | 115 |
| 25 | 3300042597 | Ga0466699_124353 | Ga0466699_124353_863_1210 | 115 |
| 26 | 3300042598 | Ga0466701_008798 | Ga0466701_008798_2326_2673 | 115 |
| 27 | 3300042598 | Ga0466701_010815 | Ga0466701_010815_5849_6196 | 115 |
| 28 | 3300042598 | Ga0466701_044531 | Ga0466701_044531_1959_2306 | 115 |
| 29 | 3300042598 | Ga0466701_054311 | Ga0466701_054311_11036_11383 | 115 |
| 30 | 3300042599 | Ga0466706_265643 | Ga0466706_265643_16_363 | 115 |
| 31 | 3300042600 | Ga0466700_145697 | Ga0466700_145697_657_1004 | 115 |
| 32 | 3300042604 | Ga0466717_100938 | Ga0466717_100938_133_480 | 115 |
| 33 | 3300042607 | Ga0466720_168378 | Ga0466720_168378_1708_2055 | 115 |
| 34 | 3300042608 | Ga0466721_120179 | Ga0466721_120179_5473_5820 | 115 |
| 35 | 3300042610 | Ga0466698_160311 | Ga0466698_160311_560_907 | 115 |
| 36 | 3300042611 | Ga0466697_035527 | Ga0466697_035527_520_867 | 115 |
| 37 | 3300042611 | Ga0466697_185668 | Ga0466697_185668_7344_7691 | 115 |
| 38 | 3300042611 | Ga0466697_218610 | Ga0466697_218610_423_770 | 115 |
| 39 | 3300042611 | Ga0466697_272518 | Ga0466697_272518_724_1071 | 115 |
| 40 | 3300042611 | Ga0466697_280078 | Ga0466697_280078_3219_3566 | 115 |
| 41 | 3300042613 | Ga0466710_239932 | Ga0466710_239932_585_932 | 115 |
| 42 | 3300042613 | Ga0466710_240933 | Ga0466710_240933_1986_2333 | 115 |
| 43 | 3300042613 | Ga0466710_247943 | Ga0466710_247943_720_1067 | 115 |
| 44 | 3300042613 | Ga0466710_331766 | Ga0466710_331766_2452_2799 | 115 |
| 45 | 3300042613 | Ga0466710_341217 | Ga0466710_341217_148_495 | 115 |
| 46 | 3300042613 | Ga0466710_402223 | Ga0466710_402223_3663_4010 | 115 |
| 47 | 3300042613 | Ga0466710_411939 | Ga0466710_411939_2141_2488 | 115 |
| 48 | 3300042614 | Ga0466712_021744 | Ga0466712_021744_1343_1690 | 115 |
| 49 | 3300042621 | Ga0466729_260968 | Ga0466729_260968_15047_15394 | 115 |
| 50 | 3300042622 | Ga0466731_013508 | Ga0466731_013508_20289_20636 | 115 |
| 51 | 3300042622 | Ga0466731_366273 | Ga0466731_366273_305_652 | 115 |
| 52 | 3300042622 | Ga0466731_408936 | Ga0466731_408936_1149_1496 | 115 |
| 53 | 3300042649 | Ga0466724_24671 | Ga0466724_24671_4016_4363 | 115 |
| 54 | 3300042649 | Ga0466724_28849 | Ga0466724_28849_1077_1424 | 115 |
| 55 | 3300042656 | Ga0466732_071292 | Ga0466732_071292_791_1138 | 115 |
| 56 | 3300042656 | Ga0466732_148829 | Ga0466732_148829_667_1014 | 115 |
| 57 | 3300042656 | Ga0466732_218134 | Ga0466732_218134_164_511 | 115 |
| 58 | iso_pr_bacteria | 2820753519 | 2820755108 | 115 |
| 59 | iso_pr_bacteria | 2820755292 | 2820756389 | 115 |
| 60 | iso_pr_bacteria | 2820783511 | 2820783689 | 115 |
| 61 | iso_pr_bacteria | 2820792843 | 2820794356 | 115 |
| 62 | iso_pr_bacteria | 2820795054 | 2820795928 | 115 |
| 63 | iso_pr_bacteria | 2820797595 | 2820797940 | 115 |
| 64 | 3300002449 | JGI24698J34947_10115736 | JGI24698J34947_101157362 | 116 |
| 65 | 3300002462 | JGI24702J35022_10061120 | JGI24702J35022_100611202 | 116 |
| 66 | 3300002462 | JGI24702J35022_10642146 | JGI24702J35022_106421461 | 116 |
| 67 | 3300002834 | JGI24696J40584_12927629 | JGI24696J40584_129276292 | 116 |
| 68 | 3300002834 | JGI24696J40584_12933348 | JGI24696J40584_129333482 | 116 |
| 69 | 3300002834 | JGI24696J40584_12960603 | JGI24696J40584_129606036 | 116 |
| 70 | 3300002834 | JGI24696J40584_12961666 | JGI24696J40584_1296166620 | 116 |
| 71 | 3300005201 | Ga0072941_1151975 | Ga0072941_11519753 | 116 |
| 72 | 3300005201 | Ga0072941_1281685 | Ga0072941_12816852 | 116 |
| 73 | 3300010049 | Ga0123356_10000992 | Ga0123356_100009923 | 116 |
| 74 | 3300010049 | Ga0123356_10032105 | Ga0123356_100321053 | 116 |
| 75 | 3300010049 | Ga0123356_10038349 | Ga0123356_100383493 | 116 |
| 76 | 3300010049 | Ga0123356_10063096 | Ga0123356_100630962 | 116 |
| 77 | 3300010049 | Ga0123356_10073423 | Ga0123356_100734232 | 116 |
| 78 | 3300010049 | Ga0123356_10564585 | Ga0123356_105645852 | 116 |
| 79 | 3300010049 | Ga0123356_10593329 | Ga0123356_105933292 | 116 |
| 80 | 3300010049 | Ga0123356_11512312 | Ga0123356_115123122 | 116 |
| 81 | 3300010049 | Ga0123356_11873641 | Ga0123356_118736412 | 116 |
| 82 | 3300010049 | Ga0123356_12204325 | Ga0123356_122043252 | 116 |
| 83 | 3300010049 | Ga0123356_13840318 | Ga0123356_138403181 | 116 |
| 84 | 3300010167 | Ga0123353_10000748 | Ga0123353_1000074814 | 116 |
| 85 | 3300010167 | Ga0123353_10012103 | Ga0123353_1001210310 | 116 |
| 86 | 3300010167 | Ga0123353_10027885 | Ga0123353_100278858 | 116 |
| 87 | 3300010167 | Ga0123353_10044389 | Ga0123353_100443894 | 116 |
| 88 | 3300010167 | Ga0123353_10719248 | Ga0123353_107192482 | 116 |
| 89 | 3300010167 | Ga0123353_11491512 | Ga0123353_114915121 | 116 |
| 90 | 3300010167 | Ga0123353_11760708 | Ga0123353_117607082 | 116 |
| 91 | 3300010167 | Ga0123353_12724106 | Ga0123353_127241061 | 116 |
| 92 | 3300010882 | Ga0123354_10111232 | Ga0123354_101112324 | 116 |
| 93 | 3300010882 | Ga0123354_10151511 | Ga0123354_101515112 | 116 |
| 94 | 3300010882 | Ga0123354_10429448 | Ga0123354_104294481 | 116 |
| 95 | 3300010882 | Ga0123354_10468689 | Ga0123354_104686892 | 116 |
| 96 | 3300010882 | Ga0123354_10992702 | Ga0123354_109927021 | 116 |
| 97 | 3300042582 | Ga0466657_066101 | Ga0466657_066101_2492_2842 | 116 |
| 98 | 3300042594 | Ga0466694_118480 | Ga0466694_118480_526_876 | 116 |
| 99 | 3300042596 | Ga0466696_219008 | Ga0466696_219008_2924_3274 | 116 |
| 100 | 3300042601 | Ga0466707_030502 | Ga0466707_030502_21_371 | 116 |
| 101 | 3300042602 | Ga0466713_056468 | Ga0466713_056468_23036_23386 | 116 |
| 102 | 3300042604 | Ga0466717_289917 | Ga0466717_289917_1497_1847 | 116 |
| 103 | 3300042611 | Ga0466697_199764 | Ga0466697_199764_258_608 | 116 |
| 104 | 3300042611 | Ga0466697_214427 | Ga0466697_214427_221_571 | 116 |
| 105 | 3300042613 | Ga0466710_354844 | Ga0466710_354844_842_1192 | 116 |
| 106 | 3300042622 | Ga0466731_377907 | Ga0466731_377907_306_656 | 116 |
| 107 | 3300042623 | Ga0466734_119759 | Ga0466734_119759_897_1247 | 116 |
| 108 | 3300042649 | Ga0466724_47668 | Ga0466724_47668_578_928 | 116 |
| 109 | 3300042659 | Ga0466733_019413 | Ga0466733_019413_806_1156 | 116 |
| 110 | 3300007190 | Ga0103267_1000096 | Ga0103267_100009628 | 117 |
| 111 | 3300007192 | Ga0103268_1000072 | Ga0103268_100007229 | 117 |
| 112 | 3300010049 | Ga0123356_10733083 | Ga0123356_107330832 | 117 |
| 113 | 3300010049 | Ga0123356_10964816 | Ga0123356_109648162 | 117 |
| 114 | 3300010049 | Ga0123356_11421224 | Ga0123356_114212242 | 117 |
| 115 | 3300010167 | Ga0123353_10066976 | Ga0123353_100669764 | 117 |
| 116 | 3300010167 | Ga0123353_11196049 | Ga0123353_111960492 | 117 |
| 117 | 3300010167 | Ga0123353_12653025 | Ga0123353_126530251 | 117 |
| 118 | 3300010167 | Ga0123353_13336183 | Ga0123353_133361832 | 117 |
| 119 | 3300024493 | Ga0264413_106288 | Ga0264413_10628822 | 117 |
| 120 | 3300042601 | Ga0466707_178168 | Ga0466707_178168_2423_2776 | 117 |
| 121 | 3300042612 | Ga0466705_434818 | Ga0466705_434818_6964_7317 | 117 |
| 122 | 3300042619 | Ga0466726_438612 | Ga0466726_438612_1321_1674 | 117 |
| 123 | 3300042643 | Ga0466704_542125 | Ga0466704_542125_5487_5840 | 117 |
| 124 | 3300000089 | AustNasuHG_c1012407 | AustNasuHG_10124072 | 118 |
| 125 | 3300000089 | AustNasuHG_c1023996 | AustNasuHG_10239962 | 118 |
| 126 | 3300002450 | JGI24695J34938_10063411 | JGI24695J34938_100634112 | 118 |
| 127 | 3300010049 | Ga0123356_12660204 | Ga0123356_126602041 | 118 |
| 128 | 3300024493 | Ga0264413_122730 | Ga0264413_1227301 | 118 |
| 129 | 3300042590 | Ga0466690_176711 | Ga0466690_176711_4214_4570 | 118 |
| 130 | 3300042597 | Ga0466699_023934 | Ga0466699_023934_5527_5883 | 118 |
| 131 | 3300042597 | Ga0466699_035963 | Ga0466699_035963_2381_2737 | 118 |
| 132 | 3300042597 | Ga0466699_104898 | Ga0466699_104898_264_620 | 118 |
| 133 | 3300042597 | Ga0466699_177171 | Ga0466699_177171_617_973 | 118 |
| 134 | 3300042597 | Ga0466699_302213 | Ga0466699_302213_5054_5410 | 118 |
| 135 | 3300042604 | Ga0466717_172868 | Ga0466717_172868_219_575 | 118 |
| 136 | 3300042616 | Ga0466715_499349 | Ga0466715_499349_6932_7288 | 118 |
| 137 | 3300042617 | Ga0466718_005487 | Ga0466718_005487_4476_4832 | 118 |
| 138 | 3300042617 | Ga0466718_115277 | Ga0466718_115277_28854_29210 | 118 |
| 139 | 3300042635 | Ga0466702_163103 | Ga0466702_163103_357_713 | 118 |
| 140 | 3300042635 | Ga0466702_325463 | Ga0466702_325463_1502_1858 | 118 |
| 141 | 3300042656 | Ga0466732_344426 | Ga0466732_344426_447_803 | 118 |
| 142 | 3300000089 | AustNasuHG_c1016130 | AustNasuHG_10161302 | 119 |
| 143 | 3300002834 | JGI24696J40584_12882192 | JGI24696J40584_128821922 | 119 |
| 144 | 3300005200 | Ga0072940_1005296 | Ga0072940_10052963 | 119 |
| 145 | 3300005200 | Ga0072940_1010570 | Ga0072940_10105702 | 119 |
| 146 | 3300010167 | Ga0123353_13006073 | Ga0123353_130060731 | 119 |
| 147 | 3300012846 | Ga0160433_100033 | Ga0160433_1000337 | 119 |
| 148 | 3300012847 | Ga0160445_102912 | Ga0160445_1029123 | 119 |
| 149 | 3300024493 | Ga0264413_100462 | Ga0264413_10046217 | 119 |
| 150 | 3300024493 | Ga0264413_106289 | Ga0264413_1062899 | 119 |
| 151 | 3300024493 | Ga0264413_109005 | Ga0264413_10900513 | 119 |
| 152 | 3300042594 | Ga0466694_119034 | Ga0466694_119034_3876_4235 | 119 |
| 153 | 3300042607 | Ga0466720_072170 | Ga0466720_072170_11243_11602 | 119 |
| 154 | 3300042607 | Ga0466720_145975 | Ga0466720_145975_40898_41257 | 119 |
| 155 | 3300042607 | Ga0466720_151338 | Ga0466720_151338_31017_31376 | 119 |
| 156 | 3300042610 | Ga0466698_109719 | Ga0466698_109719_1373_1732 | 119 |
| 157 | 3300042614 | Ga0466712_071302 | Ga0466712_071302_1162_1521 | 119 |
| 158 | 3300042614 | Ga0466712_080659 | Ga0466712_080659_5558_5917 | 119 |
| 159 | 3300042617 | Ga0466718_027213 | Ga0466718_027213_2557_2916 | 119 |
| 160 | 3300042617 | Ga0466718_062853 | Ga0466718_062853_4858_5217 | 119 |
| 161 | 3300042656 | Ga0466732_079013 | Ga0466732_079013_2963_3322 | 119 |
| 162 | iso_pr_bacteria | 2740892546 | 2743912233 | 119 |
| 163 | iso_pr_bacteria | 2773857779 | 2774479299 | 119 |
| 164 | iso_pr_bacteria | 2820716747 | 2820718638 | 119 |
| 165 | 2030936001 | Nasutiter_Contig40690 | Nasutiterm_109510 | 120 |
| 166 | 3300000089 | AustNasuHG_c1017658 | AustNasuHG_10176582 | 120 |
| 167 | 3300000089 | AustNasuHG_c1070438 | AustNasuHG_10704381 | 120 |
| 168 | 3300002449 | JGI24698J34947_10002535 | JGI24698J34947_100025357 | 120 |
| 169 | 3300002450 | JGI24695J34938_10024844 | JGI24695J34938_100248442 | 120 |
| 170 | 3300005200 | Ga0072940_1010565 | Ga0072940_10105654 | 120 |
| 171 | 3300005201 | Ga0072941_1009252 | Ga0072941_100925218 | 120 |
| 172 | 3300005201 | Ga0072941_1070141 | Ga0072941_10701414 | 120 |
| 173 | 3300005485 | Ga0074263_105271 | Ga0074263_1052712 | 120 |
| 174 | 3300024493 | Ga0264413_101950 | Ga0264413_10195012 | 120 |
| 175 | 3300042594 | Ga0466694_043881 | Ga0466694_043881_1395_1757 | 120 |
| 176 | 3300042607 | Ga0466720_007470 | Ga0466720_007470_45288_45650 | 120 |
| 177 | 3300042614 | Ga0466712_009659 | Ga0466712_009659_6905_7267 | 120 |
| 178 | 3300042614 | Ga0466712_091762 | Ga0466712_091762_11864_12226 | 120 |
| 179 | 3300042614 | Ga0466712_183453 | Ga0466712_183453_1302_1664 | 120 |
| 180 | iso_pr_bacteria | 2740892545 | 2743907789 | 120 |
| 181 | 3300002449 | JGI24698J34947_10001083 | JGI24698J34947_100010839 | 121 |
| 182 | 3300002449 | JGI24698J34947_10004703 | JGI24698J34947_100047037 | 121 |
| 183 | 3300002449 | JGI24698J34947_10017658 | JGI24698J34947_100176582 | 121 |
| 184 | 3300002507 | JGI24697J35500_11194260 | JGI24697J35500_111942602 | 121 |
| 185 | 3300005201 | Ga0072941_1000283 | Ga0072941_100028348 | 121 |
| 186 | 3300005201 | Ga0072941_1029460 | Ga0072941_102946021 | 121 |
| 187 | 3300005201 | Ga0072941_1088579 | Ga0072941_10885794 | 121 |
| 188 | 3300042594 | Ga0466694_010572 | Ga0466694_010572_34291_34656 | 121 |
| 189 | 3300042594 | Ga0466694_158131 | Ga0466694_158131_7136_7501 | 121 |
| 190 | 3300042594 | Ga0466694_302079 | Ga0466694_302079_483_848 | 121 |
| 191 | 3300042617 | Ga0466718_020474 | Ga0466718_020474_4236_4601 | 121 |
| 192 | 3300042617 | Ga0466718_132744 | Ga0466718_132744_4231_4596 | 121 |
| 193 | 3300042622 | Ga0466731_031578 | Ga0466731_031578_5783_6148 | 121 |
| 194 | 3300042656 | Ga0466732_450262 | Ga0466732_450262_3323_3688 | 121 |
| 195 | iso_pr_bacteria | 2820714932 | 2820716625 | 121 |
| 196 | 3300000089 | AustNasuHG_c1000371 | AustNasuHG_10003719 | 122 |
| 197 | 3300000089 | AustNasuHG_c1002733 | AustNasuHG_10027336 | 122 |
| 198 | 3300005200 | Ga0072940_1005379 | Ga0072940_10053791 | 122 |
| 199 | 3300005200 | Ga0072940_1066751 | Ga0072940_10667513 | 122 |
| 200 | 3300042594 | Ga0466694_102254 | Ga0466694_102254_200_571 | 123 |
| 201 | 3300010049 | Ga0123356_10789378 | Ga0123356_107893781 | 124 |
| 202 | 3300042614 | Ga0466712_059625 | Ga0466712_059625_10303_10680 | 125 |
| 203 | 3300042649 | Ga0466724_45857 | Ga0466724_45857_226_603 | 125 |
| 204 | 3300002449 | JGI24698J34947_10019875 | JGI24698J34947_100198751 | 126 |
| 205 | 3300002449 | JGI24698J34947_10028281 | JGI24698J34947_100282811 | 126 |
| 206 | 3300010167 | Ga0123353_10128127 | Ga0123353_101281275 | 126 |
| 207 | 3300038395 | Ga0415639_207511 | Ga0415639_207511_1591_1983 | 130 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02261 | Asp_decarbox | Aspartate decarboxylase | 1 | 115 | 0.96 |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c45-assembly1.cif.gz_C | NATIVE PRECURSOR OF PYRUVOYL DEPENDENT ASPARTATE DECARBOXYLASE | 0.962 | 1 | 114 |
| 3oug-assembly1.cif.gz_C | Crystal structure of cleaved L-aspartate-alpha-decarboxylase from Francisella tularensis | 0.961 | 1 | 110 |
| 1pqf-assembly1.cif.gz_B-2 | Glycine 24 to Serine mutation of aspartate decarboxylase | 0.959 | 1 | 116 |
| 4crz-assembly1.cif.gz_A | Direct visualisation of strain-induced protein prost-translational modification | 0.958 | 1 | 116 |
| 1pt1-assembly1.cif.gz_A | Unprocessed Pyruvoyl Dependent Aspartate Decarboxylase with Histidine 11 Mutated to Alanine | 0.957 | 1 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FV23_1_126_2.40.40.20 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9699 | 1 | 117 | 2.40.40.20 |
| 2c45C00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9618 | 1 | 114 | 2.40.40.20 |
| 4aonE00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9491 | 25 | 116 | 2.40.40.20 |
| 3plxB00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9445 | 26 | 117 | 2.40.40.20 |
| 1pqhA00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.94 | 1 | 116 | 2.40.40.20 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.