Protein Family IF00002

Metagenome Metatranscriptome Isolate
134 Members
38 Samples
129 Scaffolds
236.58 Avg Length

🧬 Representative Sequence

ID
2030936001|Nasutiter_Contig18609|Nasutiterm_2196770
Length
268 aa
Sequence
MKVMEKEGMVVNWSDILFNSPHAERYRKTNWRIMFMHNTENLSNYYDLLGVNRESSSSQIKKAFREKAKQLHPDIAGSDQSEAMRKLISAYEILSNPERRYEYDRAYSRFVKKAGFNYRTWLNEQDDPESQAKLVFFELLHLQEEQAIAVWRKNGGLDFLLNKYLDKEDWMDCQYILAEELDKRGFTYEAFRLSAAVLAEERRRPYFKIFTAEIEKFIKSIVRQKLKHQVDKETWIDCMETMVSLGFSARDEKRYMRYMADTLEKLRA

📊 Sample Types

Isolate 3.7%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🦗 Order Distribution

Amphipoda 0.0%
Anostraca 0.0%
Araneae 0.0%
Blattodea 0.0%
Calanoida 0.0%
Coleoptera 0.0%
Copepoda 0.0%
Decapoda 0.0%
Diplopoda 0.0%
Diplostraca 0.0%
Diptera 0.0%
Euphausiacea 0.0%
Hemiptera 0.0%
Hymenoptera 0.0%
Insect (unknown) 0.0%
Isopoda 0.0%
Isoptera 96.3%
Ixodida 0.0%
Lepidoptera 0.0%
Mecoptera 0.0%
NA 0.0%
Odonata 0.0%
Orthoptera 0.0%
Phthiraptera 0.0%
Psocodea 0.0%
Sarcoptiformes 0.0%
Siphonaptera 0.0%
Spirobolida 0.0%
Thysanoptera 0.0%
Trombidiformes 0.0%

🌳 Taxonomy

Archaea 1
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeEnvironment
1 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Isoptera
2 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Isoptera
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Isoptera
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Isoptera
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Isoptera
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Isoptera
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Isoptera
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Isoptera
9 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Isoptera
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Isoptera
11 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Isoptera
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Isoptera
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Isoptera
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Isoptera
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Isoptera
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Isoptera
17 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome Isoptera
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Isoptera
19 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Isoptera
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Isoptera
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Isoptera
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Isoptera
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Isoptera
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Isoptera
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Isoptera
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome Isoptera
27 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Isoptera
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Isoptera
29 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Isoptera
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Isoptera
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Isoptera
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Isoptera
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Isoptera
34 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Isoptera
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Isoptera
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Isoptera
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Isoptera
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Isoptera

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10001843 3300002449 Bacteria 11307
2 JGI24698J34947_10011588 3300002449 Bacteria 4841
3 JGI24698J34947_10084773 3300002449 Unclassified 1474
4 JGI24695J34938_10000190 3300002450 Bacteria 57427
5 JGI24695J34938_10039897 3300002450 Bacteria 2117
6 Ga0072941_1004258 3300005201 Bacteria 9122
7 Ga0072941_1108211 3300005201 Bacteria 1999
8 Ga0466716_119424 3300042605 Bacteria 30510
9 Ga0466719_145174 3300042606 Bacteria 49253
10 Ga0415639_072113 3300038395 Bacteria 986
11 Ga0466692_162226 3300042591 Bacteria 5497
12 Ga0466691_014585 3300042593 Bacteria 20179
13 Ga0466694_271285 3300042594 Bacteria 1385
14 Ga0466699_011117 3300042597 Bacteria 1817
15 Ga0466712_028735 3300042614 Bacteria 38990
16 Ga0466712_035454 3300042614 Bacteria 21926
17 Ga0466718_010881 3300042617 Bacteria 2290
18 AustNasuHG_c1000005 3300000089 Bacteria 56942
19 AustNasuHG_c1031215 3300000089 Bacteria 1511
20 JGI24698J34947_10001592 3300002449 Bacteria 12046
21 JGI24698J34947_10020479 3300002449 Bacteria 3561
22 JGI24698J34947_10051179 3300002449 Bacteria 2079
23 Ga0466722_188440 3300042609 Bacteria 3796
24 Ga0466698_011176 3300042610 Bacteria 17753
25 Ga0264413_100206 3300024493 Bacteria 2253
26 Ga0264413_106415 3300024493 Bacteria 1313
27 Ga0264413_107168 3300024493 Bacteria 47740
28 Ga0264413_116627 3300024493 Archaea 4585
29 Ga0466690_002751 3300042590 Bacteria 16420
30 Ga0466692_106643 3300042591 Bacteria 23149
31 Ga0466699_027011 3300042597 Bacteria 4620
32 Ga0466699_165217 3300042597 Bacteria 13505
33 Ga0466718_139511 3300042617 Bacteria 3770
34 Ga0466702_356971 3300042635 Bacteria 1796
35 Ga0466708_436074 3300042652 Bacteria 8064
36 Ga0123357_10125138 3300009784 Bacteria 3223
37 Ga0123356_10004765 3300010049 Bacteria 13956
38 Ga0072941_1008564 3300005201 Bacteria 7816
39 Ga0072941_1019152 3300005201 Unclassified 3777
40 Ga0072941_1083459 3300005201 Bacteria 5085
41 Ga0466694_011295 3300042594 Bacteria 21289
42 Ga0466694_092760 3300042594 Bacteria 30658
43 Ga0466718_094669 3300042617 Bacteria 12438
44 Ga0466718_096890 3300042617 Bacteria 1317
45 Ga0466735_204380 3300042624 Bacteria 2684
46 JGI24698J34947_10002785 3300002449 Bacteria 9467
47 JGI24698J34947_10007900 3300002449 Bacteria 5844
48 JGI24698J34947_10007941 3300002449 Bacteria 5827
49 JGI24698J34947_10024116 3300002449 Bacteria 3250
50 JGI24698J34947_10060740 3300002449 Bacteria 1863
51 Ga0415639_034740 3300038395 Bacteria 2879
52 Ga0466694_010922 3300042594 Bacteria 2935
53 Ga0466694_085676 3300042594 Bacteria 6201
54 Ga0466712_003932 3300042614 Bacteria 1716
55 Ga0466712_043689 3300042614 Bacteria 6200
56 Ga0466712_313417 3300042614 Bacteria 20202
57 Ga0466718_000437 3300042617 Bacteria 6193
58 Ga0466718_014084 3300042617 Bacteria 9337
59 Ga0466718_098402 3300042617 Bacteria 5328
60 Ga0466723_287515 3300042618 Bacteria 14214
61 Ga0466735_053746 3300042624 Bacteria 2906
62 Ga0466702_262024 3300042635 Bacteria 19372
63 Ga0123356_10677138 3300010049 Bacteria 1200
64 JGI24698J34947_10110380 3300002449 Bacteria 1216
65 JGI24695J34938_10006897 3300002450 Bacteria 6743
66 Ga0072941_1259230 3300005201 Bacteria 2380
67 Ga0264413_102311 3300024493 Bacteria 23114
68 Ga0466701_011177 3300042598 Bacteria 1035
69 Ga0466712_039240 3300042614 Bacteria 23177
70 Ga0466711_310728 3300042615 Bacteria 12530
71 Ga0466718_046216 3300042617 Bacteria 3669
72 Ga0466718_083414 3300042617 Bacteria 1575
73 Ga0466718_152670 3300042617 Bacteria 7225
74 Ga0466728_103464 3300042620 Bacteria 27893
75 Ga0466731_229103 3300042622 Bacteria 2459
76 Ga0466702_349925 3300042635 Bacteria 1684
77 Ga0123354_10378206 3300010882 Unclassified 1226
78 Ga0466732_149862 3300042656 Bacteria 25512
79 Nasutiter_Contig18609 2030936001 Bacteria 2094
80 JGI24698J34947_10001809 3300002449 Bacteria 11411
81 JGI24698J34947_10002702 3300002449 Bacteria 9575
82 JGI24695J34938_10000034 3300002450 Bacteria 102252
83 JGI24695J34938_10000090 3300002450 Bacteria 79670
84 Ga0072941_1187355 3300005201 Bacteria 2031
85 Ga0466720_040398 3300042607 Bacteria 4140
86 Ga0466721_282865 3300042608 Bacteria 3385
87 Ga0466699_078894 3300042597 Bacteria 2536
88 Ga0466705_481415 3300042612 Bacteria 10350
89 Ga0466718_006492 3300042617 Bacteria 5152
90 Ga0466702_096891 3300042635 Bacteria 5454
91 Ga0123356_10001171 3300010049 Bacteria 29024
92 JGI24698J34947_10016628 3300002449 Bacteria 3991
93 Ga0072941_1001733 3300005201 Bacteria 27546
94 Ga0072941_1029428 3300005201 Bacteria 1535
95 Ga0072941_1078560 3300005201 Bacteria 3271
96 Ga0072941_1128740 3300005201 Bacteria 3079
97 Ga0466716_004127 3300042605 Bacteria 19130
98 Ga0466720_067539 3300042607 Bacteria 32042
99 Ga0466722_140791 3300042609 Bacteria 30365
100 Ga0255786_1000339 3300022815 Bacteria 2647
101 Ga0264413_128808 3300024493 Bacteria 1926
102 Ga0415639_160200 3300038395 Bacteria 2266
103 Ga0466694_061918 3300042594 Bacteria 2938
104 Ga0466694_064514 3300042594 Bacteria 49364
105 Ga0466712_066859 3300042614 Bacteria 17566
106 Ga0466712_096882 3300042614 Bacteria 42313
107 Ga0466712_321604 3300042614 Bacteria 1423
108 Ga0466723_069830 3300042618 Bacteria 59394
109 Ga0466731_122857 3300042622 Bacteria 1844
110 Ga0466702_013549 3300042635 Bacteria 1808
111 Ga0466704_133824 3300042643 Bacteria 15469
112 Ga0123356_10019089 3300010049 Bacteria 6502
113 Ga0466732_402929 3300042656 Bacteria 3380
114 JGI24698J34947_10000264 3300002449 Bacteria 22404
115 JGI24698J34947_10020922 3300002449 Bacteria 3522
116 JGI24698J34947_10055318 3300002449 Bacteria 1977
117 JGI24698J34947_10075599 3300002449 Bacteria 1601
118 Ga0072941_1006115 3300005201 Bacteria 5434
119 Ga0466700_009779 3300042600 Bacteria 2411
120 Ga0466720_044223 3300042607 Bacteria 4336
121 Ga0466720_045337 3300042607 Bacteria 10655
122 Ga0466699_420355 3300042597 Bacteria 7481
123 Ga0466712_026582 3300042614 Bacteria 12812
124 Ga0466712_127955 3300042614 Bacteria 54818
125 Ga0466712_152932 3300042614 Bacteria 25376
126 Ga0466712_269723 3300042614 Bacteria 3433
127 Ga0466703_315219 3300042636 Bacteria 14962
128 Ga0466709_104493 3300042648 Bacteria 13448
129 Ga0123356_10064051 3300010049 Bacteria 3436

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_094669 Ga0466718_094669_852_1541 220
2 3300024493 Ga0264413_106415 Ga0264413_1064152 221
3 3300042614 Ga0466712_035454 Ga0466712_035454_8468_9169 223
4 3300042656 Ga0466732_402929 Ga0466732_402929_871_1551 226
5 3300022815 Ga0255786_1000339 Ga0255786_10003394 227
6 3300024493 Ga0264413_107168 Ga0264413_1071686 227
7 3300038395 Ga0415639_034740 Ga0415639_034740_695_1378 227
8 3300038395 Ga0415639_160200 Ga0415639_160200_987_1670 227
9 3300042594 Ga0466694_092760 Ga0466694_092760_6322_7005 227
10 3300042594 Ga0466694_271285 Ga0466694_271285_583_1266 227
11 3300042597 Ga0466699_078894 Ga0466699_078894_973_1656 227
12 3300042600 Ga0466700_009779 Ga0466700_009779_1090_1773 227
13 3300042614 Ga0466712_026582 Ga0466712_026582_3338_4021 227
14 3300042614 Ga0466712_066859 Ga0466712_066859_9317_10000 227
15 3300042614 Ga0466712_152932 Ga0466712_152932_11689_12372 227
16 3300042614 Ga0466712_313417 Ga0466712_313417_13446_14129 227
17 3300042617 Ga0466718_000437 Ga0466718_000437_4645_5328 227
18 3300042617 Ga0466718_139511 Ga0466718_139511_2788_3471 227
19 3300042635 Ga0466702_096891 Ga0466702_096891_4257_4940 227
20 3300042635 Ga0466702_349925 Ga0466702_349925_206_889 227
21 iso_pr_bacteria 2781125644 2781295647 227
22 3300002449 JGI24698J34947_10001592 JGI24698J34947_1000159211 228
23 3300002449 JGI24698J34947_10002785 JGI24698J34947_1000278512 228
24 3300002449 JGI24698J34947_10011588 JGI24698J34947_100115885 228
25 3300002449 JGI24698J34947_10020922 JGI24698J34947_100209222 228
26 3300002449 JGI24698J34947_10084773 JGI24698J34947_100847732 228
27 3300002450 JGI24695J34938_10000190 JGI24695J34938_1000019021 228
28 3300005201 Ga0072941_1078560 Ga0072941_10785603 228
29 3300005201 Ga0072941_1128740 Ga0072941_11287403 228
30 3300042614 Ga0466712_003932 Ga0466712_003932_842_1528 228
31 3300042614 Ga0466712_039240 Ga0466712_039240_13060_13746 228
32 3300042614 Ga0466712_269723 Ga0466712_269723_37_723 228
33 3300042614 Ga0466712_321604 Ga0466712_321604_239_925 228
34 3300042622 Ga0466731_229103 Ga0466731_229103_51_737 228
35 3300042635 Ga0466702_356971 Ga0466702_356971_652_1338 228
36 iso_pr_bacteria 2781125665 2781342130 228
37 3300002449 JGI24698J34947_10001809 JGI24698J34947_100018094 229
38 3300002449 JGI24698J34947_10007941 JGI24698J34947_100079413 229
39 3300002449 JGI24698J34947_10055318 JGI24698J34947_100553184 229
40 3300002449 JGI24698J34947_10110380 JGI24698J34947_101103802 229
41 3300005201 Ga0072941_1008564 Ga0072941_10085644 229
42 3300010049 Ga0123356_10019089 Ga0123356_100190892 229
43 3300024493 Ga0264413_102311 Ga0264413_1023115 229
44 3300042594 Ga0466694_085676 Ga0466694_085676_1175_1864 229
45 3300042597 Ga0466699_165217 Ga0466699_165217_3744_4433 229
46 3300042597 Ga0466699_420355 Ga0466699_420355_3743_4432 229
47 3300042607 Ga0466720_067539 Ga0466720_067539_15152_15841 229
48 3300042614 Ga0466712_028735 Ga0466712_028735_12313_13002 229
49 3300042614 Ga0466712_127955 Ga0466712_127955_37151_37840 229
50 3300042617 Ga0466718_006492 Ga0466718_006492_1359_2048 229
51 3300042617 Ga0466718_010881 Ga0466718_010881_34_723 229
52 3300042617 Ga0466718_014084 Ga0466718_014084_7249_7938 229
53 3300042617 Ga0466718_098402 Ga0466718_098402_1535_2224 229
54 3300042635 Ga0466702_013549 Ga0466702_013549_512_1201 229
55 iso_pr_bacteria 2781125634 2781275130 229
56 3300002449 JGI24698J34947_10000264 JGI24698J34947_1000026430 230
57 3300002449 JGI24698J34947_10020479 JGI24698J34947_100204793 230
58 3300002450 JGI24695J34938_10000090 JGI24695J34938_1000009032 230
59 3300002450 JGI24695J34938_10006897 JGI24695J34938_100068973 230
60 3300005201 Ga0072941_1001733 Ga0072941_100173319 230
61 3300005201 Ga0072941_1019152 Ga0072941_10191525 230
62 3300005201 Ga0072941_1083459 Ga0072941_10834595 230
63 3300005201 Ga0072941_1187355 Ga0072941_11873553 230
64 3300005201 Ga0072941_1259230 Ga0072941_12592302 230
65 3300042594 Ga0466694_010922 Ga0466694_010922_803_1495 230
66 3300042594 Ga0466694_011295 Ga0466694_011295_752_1444 230
67 3300042594 Ga0466694_061918 Ga0466694_061918_589_1281 230
68 3300042614 Ga0466712_043689 Ga0466712_043689_1474_2166 230
69 3300042617 Ga0466718_083414 Ga0466718_083414_319_1011 230
70 3300042635 Ga0466702_262024 Ga0466702_262024_12779_13471 230
71 3300000089 AustNasuHG_c1000005 AustNasuHG_100000537 231
72 3300002449 JGI24698J34947_10024116 JGI24698J34947_100241162 231
73 3300005201 Ga0072941_1029428 Ga0072941_10294281 231
74 3300005201 Ga0072941_1108211 Ga0072941_11082114 231
75 3300002449 JGI24698J34947_10016628 JGI24698J34947_100166282 233
76 3300024493 Ga0264413_100206 Ga0264413_1002064 233
77 3300024493 Ga0264413_128808 Ga0264413_1288084 233
78 3300038395 Ga0415639_072113 Ga0415639_072113_143_844 233
79 3300042607 Ga0466720_040398 Ga0466720_040398_958_1659 233
80 3300042607 Ga0466720_044223 Ga0466720_044223_2660_3361 233
81 3300042610 Ga0466698_011176 Ga0466698_011176_2340_3041 233
82 3300042617 Ga0466718_046216 Ga0466718_046216_2668_3369 233
83 3300042617 Ga0466718_096890 Ga0466718_096890_302_1003 233
84 3300042617 Ga0466718_152670 Ga0466718_152670_4731_5432 233
85 3300042656 Ga0466732_149862 Ga0466732_149862_20791_21492 233
86 3300000089 AustNasuHG_c1031215 AustNasuHG_10312152 234
87 3300042614 Ga0466712_096882 Ga0466712_096882_9952_10656 234
88 iso_pr_bacteria 2781125636 2781280808 234
89 iso_pr_bacteria 2781125646 2781300430 234
90 3300002450 JGI24695J34938_10000034 JGI24695J34938_1000003420 235
91 3300002450 JGI24695J34938_10039897 JGI24695J34938_100398972 235
92 3300024493 Ga0264413_116627 Ga0264413_1166274 235
93 3300042597 Ga0466699_027011 Ga0466699_027011_3633_4340 235
94 3300042598 Ga0466701_011177 Ga0466701_011177_256_963 235
95 3300042608 Ga0466721_282865 Ga0466721_282865_1796_2506 236
96 3300042622 Ga0466731_122857 Ga0466731_122857_1080_1790 236
97 3300010049 Ga0123356_10004765 Ga0123356_1000476513 237
98 3300010049 Ga0123356_10064051 Ga0123356_100640513 237
99 3300042607 Ga0466720_045337 Ga0466720_045337_4068_4784 238
100 3300042597 Ga0466699_011117 Ga0466699_011117_351_1070 239
101 3300042594 Ga0466694_064514 Ga0466694_064514_30718_31440 240
102 3300005201 Ga0072941_1004258 Ga0072941_10042589 241
103 3300010049 Ga0123356_10001171 Ga0123356_1000117144 242
104 3300010049 Ga0123356_10677138 Ga0123356_106771382 242
105 3300042605 Ga0466716_004127 Ga0466716_004127_1177_1908 243
106 3300042624 Ga0466735_204380 Ga0466735_204380_1413_2144 243
107 3300042652 Ga0466708_436074 Ga0466708_436074_4265_4996 243
108 3300042609 Ga0466722_188440 Ga0466722_188440_786_1562 245
109 3300042590 Ga0466690_002751 Ga0466690_002751_13996_14772 258
110 3300042591 Ga0466692_106643 Ga0466692_106643_4638_5414 258
111 3300042593 Ga0466691_014585 Ga0466691_014585_7794_8570 258
112 3300042605 Ga0466716_119424 Ga0466716_119424_29076_29852 258
113 3300042606 Ga0466719_145174 Ga0466719_145174_15108_15884 258
114 3300042612 Ga0466705_481415 Ga0466705_481415_6882_7658 258
115 3300042615 Ga0466711_310728 Ga0466711_310728_1111_1887 258
116 3300042618 Ga0466723_069830 Ga0466723_069830_14289_15065 258
117 3300042618 Ga0466723_287515 Ga0466723_287515_13157_13933 258
118 3300042620 Ga0466728_103464 Ga0466728_103464_20299_21075 258
119 3300042624 Ga0466735_053746 Ga0466735_053746_890_1666 258
120 3300042636 Ga0466703_315219 Ga0466703_315219_11613_12389 258
121 3300042643 Ga0466704_133824 Ga0466704_133824_13651_14427 258
122 3300042648 Ga0466709_104493 Ga0466709_104493_1844_2620 258
123 3300002449 JGI24698J34947_10001843 JGI24698J34947_100018437 259
124 3300002449 JGI24698J34947_10007900 JGI24698J34947_100079004 259
125 3300002449 JGI24698J34947_10051179 JGI24698J34947_100511792 259
126 3300002449 JGI24698J34947_10075599 JGI24698J34947_100755993 259
127 3300005201 Ga0072941_1006115 Ga0072941_10061153 259
128 3300042591 Ga0466692_162226 Ga0466692_162226_61_840 259
129 3300009784 Ga0123357_10125138 Ga0123357_101251383 260
130 3300042609 Ga0466722_140791 Ga0466722_140791_17945_18733 262
131 2030936001 Nasutiter_Contig18609 Nasutiterm_2196770 268
132 3300010882 Ga0123354_10378206 Ga0123354_103782062 269
133 3300002449 JGI24698J34947_10060740 JGI24698J34947_100607403 272
134 3300002449 JGI24698J34947_10002702 JGI24698J34947_100027029 275

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00226 DnaJ DnaJ domain 44 104 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.