Protein Family IF00002

Metagenome Metatranscriptome Isolate
134 Members
43 Samples
129 Scaffolds
236.58 Avg Length

🧬 Representative Sequence

ID
2030936001|Nasutiter_Contig18609|Nasutiterm_2196770
Length
268 aa
Sequence
MKVMEKEGMVVNWSDILFNSPHAERYRKTNWRIMFMHNTENLSNYYDLLGVNRESSSSQIKKAFREKAKQLHPDIAGSDQSEAMRKLISAYEILSNPERRYEYDRAYSRFVKKAGFNYRTWLNEQDDPESQAKLVFFELLHLQEEQAIAVWRKNGGLDFLLNKYLDKEDWMDCQYILAEELDKRGFTYEAFRLSAAVLAEERRRPYFKIFTAEIEKFIKSIVRQKLKHQVDKETWIDCMETMVSLGFSARDEKRYMRYMADTLEKLRA

📊 Sample Types

Isolate 3.7%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.2%
Kalotermitidae 29.3%
Unclassified 12.2%
Rhinotermitidae 4.9%
Termopsidae 2.4%

🌳 Taxonomy

Archaea 1
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
8 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
9 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
10 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
19 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10378206 3300010882 Unclassified 1226
2 JGI24698J34947_10110380 3300002449 Bacteria 1216
3 JGI24695J34938_10006897 3300002450 Bacteria 6743
4 Ga0072941_1259230 3300005201 Bacteria 2380
5 Ga0264413_102311 3300024493 Bacteria 23114
6 Ga0466701_011177 3300042598 Bacteria 1035
7 Ga0466712_039240 3300042614 Bacteria 23177
8 Ga0466711_310728 3300042615 Bacteria 12530
9 Ga0466718_046216 3300042617 Bacteria 3669
10 Ga0466718_083414 3300042617 Bacteria 1575
11 Ga0466718_152670 3300042617 Bacteria 7225
12 Ga0466728_103464 3300042620 Bacteria 27893
13 Ga0466731_229103 3300042622 Bacteria 2459
14 Ga0466702_349925 3300042635 Bacteria 1684
15 Ga0466716_119424 3300042605 Bacteria 30510
16 Ga0466719_145174 3300042606 Bacteria 49253
17 JGI24698J34947_10001843 3300002449 Bacteria 11307
18 JGI24698J34947_10011588 3300002449 Bacteria 4841
19 JGI24698J34947_10084773 3300002449 Unclassified 1474
20 JGI24695J34938_10000190 3300002450 Bacteria 57427
21 JGI24695J34938_10039897 3300002450 Bacteria 2117
22 Ga0072941_1004258 3300005201 Bacteria 9122
23 Ga0072941_1108211 3300005201 Bacteria 1999
24 Ga0415639_072113 3300038395 Bacteria 986
25 Ga0466692_162226 3300042591 Bacteria 5497
26 Ga0466691_014585 3300042593 Bacteria 20179
27 Ga0466694_271285 3300042594 Bacteria 1385
28 Ga0466699_011117 3300042597 Bacteria 1817
29 Ga0466712_028735 3300042614 Bacteria 38990
30 Ga0466712_035454 3300042614 Bacteria 21926
31 Ga0466718_010881 3300042617 Bacteria 2290
32 Ga0123356_10019089 3300010049 Bacteria 6502
33 Ga0466716_004127 3300042605 Bacteria 19130
34 Ga0466720_067539 3300042607 Bacteria 32042
35 Ga0466722_140791 3300042609 Bacteria 30365
36 JGI24698J34947_10016628 3300002449 Bacteria 3991
37 Ga0072941_1001733 3300005201 Bacteria 27546
38 Ga0072941_1029428 3300005201 Bacteria 1535
39 Ga0072941_1078560 3300005201 Bacteria 3271
40 Ga0072941_1128740 3300005201 Bacteria 3079
41 Ga0255786_1000339 3300022815 Bacteria 2647
42 Ga0264413_128808 3300024493 Bacteria 1926
43 Ga0415639_160200 3300038395 Bacteria 2266
44 Ga0466694_061918 3300042594 Bacteria 2938
45 Ga0466694_064514 3300042594 Bacteria 49364
46 Ga0466712_066859 3300042614 Bacteria 17566
47 Ga0466712_096882 3300042614 Bacteria 42313
48 Ga0466712_321604 3300042614 Bacteria 1423
49 Ga0466723_069830 3300042618 Bacteria 59394
50 Ga0466731_122857 3300042622 Bacteria 1844
51 Ga0466702_013549 3300042635 Bacteria 1808
52 Ga0466704_133824 3300042643 Bacteria 15469
53 Ga0466732_149862 3300042656 Bacteria 25512
54 Ga0123356_10001171 3300010049 Bacteria 29024
55 Ga0466720_040398 3300042607 Bacteria 4140
56 Ga0466721_282865 3300042608 Bacteria 3385
57 Nasutiter_Contig18609 2030936001 Bacteria 2094
58 JGI24698J34947_10001809 3300002449 Bacteria 11411
59 JGI24698J34947_10002702 3300002449 Bacteria 9575
60 JGI24695J34938_10000034 3300002450 Bacteria 102252
61 JGI24695J34938_10000090 3300002450 Bacteria 79670
62 Ga0072941_1187355 3300005201 Bacteria 2031
63 Ga0466699_078894 3300042597 Bacteria 2536
64 Ga0466705_481415 3300042612 Bacteria 10350
65 Ga0466718_006492 3300042617 Bacteria 5152
66 Ga0466702_096891 3300042635 Bacteria 5454
67 Ga0072941_1008564 3300005201 Bacteria 7816
68 Ga0072941_1019152 3300005201 Unclassified 3777
69 Ga0072941_1083459 3300005201 Bacteria 5085
70 Ga0466694_011295 3300042594 Bacteria 21289
71 Ga0466694_092760 3300042594 Bacteria 30658
72 Ga0466718_094669 3300042617 Bacteria 12438
73 Ga0466718_096890 3300042617 Bacteria 1317
74 Ga0466735_204380 3300042624 Bacteria 2684
75 Ga0466732_402929 3300042656 Bacteria 3380
76 Ga0123356_10064051 3300010049 Bacteria 3436
77 Ga0466700_009779 3300042600 Bacteria 2411
78 Ga0466720_044223 3300042607 Bacteria 4336
79 Ga0466720_045337 3300042607 Bacteria 10655
80 JGI24698J34947_10000264 3300002449 Bacteria 22404
81 JGI24698J34947_10020922 3300002449 Bacteria 3522
82 JGI24698J34947_10055318 3300002449 Bacteria 1977
83 JGI24698J34947_10075599 3300002449 Bacteria 1601
84 Ga0072941_1006115 3300005201 Bacteria 5434
85 Ga0466699_420355 3300042597 Bacteria 7481
86 Ga0466712_026582 3300042614 Bacteria 12812
87 Ga0466712_127955 3300042614 Bacteria 54818
88 Ga0466712_152932 3300042614 Bacteria 25376
89 Ga0466712_269723 3300042614 Bacteria 3433
90 Ga0466703_315219 3300042636 Bacteria 14962
91 Ga0466709_104493 3300042648 Bacteria 13448
92 Ga0123356_10677138 3300010049 Bacteria 1200
93 JGI24698J34947_10002785 3300002449 Bacteria 9467
94 JGI24698J34947_10007900 3300002449 Bacteria 5844
95 JGI24698J34947_10007941 3300002449 Bacteria 5827
96 JGI24698J34947_10024116 3300002449 Bacteria 3250
97 JGI24698J34947_10060740 3300002449 Bacteria 1863
98 Ga0415639_034740 3300038395 Bacteria 2879
99 Ga0466694_010922 3300042594 Bacteria 2935
100 Ga0466694_085676 3300042594 Bacteria 6201
101 Ga0466712_003932 3300042614 Bacteria 1716
102 Ga0466712_043689 3300042614 Bacteria 6200
103 Ga0466712_313417 3300042614 Bacteria 20202
104 Ga0466718_000437 3300042617 Bacteria 6193
105 Ga0466718_014084 3300042617 Bacteria 9337
106 Ga0466718_098402 3300042617 Bacteria 5328
107 Ga0466723_287515 3300042618 Bacteria 14214
108 Ga0466735_053746 3300042624 Bacteria 2906
109 Ga0466702_262024 3300042635 Bacteria 19372
110 Ga0123357_10125138 3300009784 Bacteria 3223
111 Ga0123356_10004765 3300010049 Bacteria 13956
112 Ga0466722_188440 3300042609 Bacteria 3796
113 Ga0466698_011176 3300042610 Bacteria 17753
114 AustNasuHG_c1000005 3300000089 Bacteria 56942
115 AustNasuHG_c1031215 3300000089 Bacteria 1511
116 JGI24698J34947_10001592 3300002449 Bacteria 12046
117 JGI24698J34947_10020479 3300002449 Bacteria 3561
118 JGI24698J34947_10051179 3300002449 Bacteria 2079
119 Ga0264413_100206 3300024493 Bacteria 2253
120 Ga0264413_106415 3300024493 Bacteria 1313
121 Ga0264413_107168 3300024493 Bacteria 47740
122 Ga0264413_116627 3300024493 Archaea 4585
123 Ga0466690_002751 3300042590 Bacteria 16420
124 Ga0466692_106643 3300042591 Bacteria 23149
125 Ga0466699_027011 3300042597 Bacteria 4620
126 Ga0466699_165217 3300042597 Bacteria 13505
127 Ga0466718_139511 3300042617 Bacteria 3770
128 Ga0466702_356971 3300042635 Bacteria 1796
129 Ga0466708_436074 3300042652 Bacteria 8064

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_094669 Ga0466718_094669_852_1541 220
2 3300024493 Ga0264413_106415 Ga0264413_1064152 221
3 3300042614 Ga0466712_035454 Ga0466712_035454_8468_9169 223
4 3300042656 Ga0466732_402929 Ga0466732_402929_871_1551 226
5 3300022815 Ga0255786_1000339 Ga0255786_10003394 227
6 3300024493 Ga0264413_107168 Ga0264413_1071686 227
7 3300038395 Ga0415639_034740 Ga0415639_034740_695_1378 227
8 3300038395 Ga0415639_160200 Ga0415639_160200_987_1670 227
9 3300042594 Ga0466694_092760 Ga0466694_092760_6322_7005 227
10 3300042594 Ga0466694_271285 Ga0466694_271285_583_1266 227
11 3300042597 Ga0466699_078894 Ga0466699_078894_973_1656 227
12 3300042600 Ga0466700_009779 Ga0466700_009779_1090_1773 227
13 3300042614 Ga0466712_026582 Ga0466712_026582_3338_4021 227
14 3300042614 Ga0466712_066859 Ga0466712_066859_9317_10000 227
15 3300042614 Ga0466712_152932 Ga0466712_152932_11689_12372 227
16 3300042614 Ga0466712_313417 Ga0466712_313417_13446_14129 227
17 3300042617 Ga0466718_000437 Ga0466718_000437_4645_5328 227
18 3300042617 Ga0466718_139511 Ga0466718_139511_2788_3471 227
19 3300042635 Ga0466702_096891 Ga0466702_096891_4257_4940 227
20 3300042635 Ga0466702_349925 Ga0466702_349925_206_889 227
21 iso_pr_bacteria 2781125644 2781295647 227
22 3300002449 JGI24698J34947_10001592 JGI24698J34947_1000159211 228
23 3300002449 JGI24698J34947_10002785 JGI24698J34947_1000278512 228
24 3300002449 JGI24698J34947_10011588 JGI24698J34947_100115885 228
25 3300002449 JGI24698J34947_10020922 JGI24698J34947_100209222 228
26 3300002449 JGI24698J34947_10084773 JGI24698J34947_100847732 228
27 3300002450 JGI24695J34938_10000190 JGI24695J34938_1000019021 228
28 3300005201 Ga0072941_1078560 Ga0072941_10785603 228
29 3300005201 Ga0072941_1128740 Ga0072941_11287403 228
30 3300042614 Ga0466712_003932 Ga0466712_003932_842_1528 228
31 3300042614 Ga0466712_039240 Ga0466712_039240_13060_13746 228
32 3300042614 Ga0466712_269723 Ga0466712_269723_37_723 228
33 3300042614 Ga0466712_321604 Ga0466712_321604_239_925 228
34 3300042622 Ga0466731_229103 Ga0466731_229103_51_737 228
35 3300042635 Ga0466702_356971 Ga0466702_356971_652_1338 228
36 iso_pr_bacteria 2781125665 2781342130 228
37 3300002449 JGI24698J34947_10001809 JGI24698J34947_100018094 229
38 3300002449 JGI24698J34947_10007941 JGI24698J34947_100079413 229
39 3300002449 JGI24698J34947_10055318 JGI24698J34947_100553184 229
40 3300002449 JGI24698J34947_10110380 JGI24698J34947_101103802 229
41 3300005201 Ga0072941_1008564 Ga0072941_10085644 229
42 3300010049 Ga0123356_10019089 Ga0123356_100190892 229
43 3300024493 Ga0264413_102311 Ga0264413_1023115 229
44 3300042594 Ga0466694_085676 Ga0466694_085676_1175_1864 229
45 3300042597 Ga0466699_165217 Ga0466699_165217_3744_4433 229
46 3300042597 Ga0466699_420355 Ga0466699_420355_3743_4432 229
47 3300042607 Ga0466720_067539 Ga0466720_067539_15152_15841 229
48 3300042614 Ga0466712_028735 Ga0466712_028735_12313_13002 229
49 3300042614 Ga0466712_127955 Ga0466712_127955_37151_37840 229
50 3300042617 Ga0466718_006492 Ga0466718_006492_1359_2048 229
51 3300042617 Ga0466718_010881 Ga0466718_010881_34_723 229
52 3300042617 Ga0466718_014084 Ga0466718_014084_7249_7938 229
53 3300042617 Ga0466718_098402 Ga0466718_098402_1535_2224 229
54 3300042635 Ga0466702_013549 Ga0466702_013549_512_1201 229
55 iso_pr_bacteria 2781125634 2781275130 229
56 3300002449 JGI24698J34947_10000264 JGI24698J34947_1000026430 230
57 3300002449 JGI24698J34947_10020479 JGI24698J34947_100204793 230
58 3300002450 JGI24695J34938_10000090 JGI24695J34938_1000009032 230
59 3300002450 JGI24695J34938_10006897 JGI24695J34938_100068973 230
60 3300005201 Ga0072941_1001733 Ga0072941_100173319 230
61 3300005201 Ga0072941_1019152 Ga0072941_10191525 230
62 3300005201 Ga0072941_1083459 Ga0072941_10834595 230
63 3300005201 Ga0072941_1187355 Ga0072941_11873553 230
64 3300005201 Ga0072941_1259230 Ga0072941_12592302 230
65 3300042594 Ga0466694_010922 Ga0466694_010922_803_1495 230
66 3300042594 Ga0466694_011295 Ga0466694_011295_752_1444 230
67 3300042594 Ga0466694_061918 Ga0466694_061918_589_1281 230
68 3300042614 Ga0466712_043689 Ga0466712_043689_1474_2166 230
69 3300042617 Ga0466718_083414 Ga0466718_083414_319_1011 230
70 3300042635 Ga0466702_262024 Ga0466702_262024_12779_13471 230
71 3300000089 AustNasuHG_c1000005 AustNasuHG_100000537 231
72 3300002449 JGI24698J34947_10024116 JGI24698J34947_100241162 231
73 3300005201 Ga0072941_1029428 Ga0072941_10294281 231
74 3300005201 Ga0072941_1108211 Ga0072941_11082114 231
75 3300002449 JGI24698J34947_10016628 JGI24698J34947_100166282 233
76 3300024493 Ga0264413_100206 Ga0264413_1002064 233
77 3300024493 Ga0264413_128808 Ga0264413_1288084 233
78 3300038395 Ga0415639_072113 Ga0415639_072113_143_844 233
79 3300042607 Ga0466720_040398 Ga0466720_040398_958_1659 233
80 3300042607 Ga0466720_044223 Ga0466720_044223_2660_3361 233
81 3300042610 Ga0466698_011176 Ga0466698_011176_2340_3041 233
82 3300042617 Ga0466718_046216 Ga0466718_046216_2668_3369 233
83 3300042617 Ga0466718_096890 Ga0466718_096890_302_1003 233
84 3300042617 Ga0466718_152670 Ga0466718_152670_4731_5432 233
85 3300042656 Ga0466732_149862 Ga0466732_149862_20791_21492 233
86 3300000089 AustNasuHG_c1031215 AustNasuHG_10312152 234
87 3300042614 Ga0466712_096882 Ga0466712_096882_9952_10656 234
88 iso_pr_bacteria 2781125636 2781280808 234
89 iso_pr_bacteria 2781125646 2781300430 234
90 3300002450 JGI24695J34938_10000034 JGI24695J34938_1000003420 235
91 3300002450 JGI24695J34938_10039897 JGI24695J34938_100398972 235
92 3300024493 Ga0264413_116627 Ga0264413_1166274 235
93 3300042597 Ga0466699_027011 Ga0466699_027011_3633_4340 235
94 3300042598 Ga0466701_011177 Ga0466701_011177_256_963 235
95 3300042608 Ga0466721_282865 Ga0466721_282865_1796_2506 236
96 3300042622 Ga0466731_122857 Ga0466731_122857_1080_1790 236
97 3300010049 Ga0123356_10004765 Ga0123356_1000476513 237
98 3300010049 Ga0123356_10064051 Ga0123356_100640513 237
99 3300042607 Ga0466720_045337 Ga0466720_045337_4068_4784 238
100 3300042597 Ga0466699_011117 Ga0466699_011117_351_1070 239
101 3300042594 Ga0466694_064514 Ga0466694_064514_30718_31440 240
102 3300005201 Ga0072941_1004258 Ga0072941_10042589 241
103 3300010049 Ga0123356_10001171 Ga0123356_1000117144 242
104 3300010049 Ga0123356_10677138 Ga0123356_106771382 242
105 3300042605 Ga0466716_004127 Ga0466716_004127_1177_1908 243
106 3300042624 Ga0466735_204380 Ga0466735_204380_1413_2144 243
107 3300042652 Ga0466708_436074 Ga0466708_436074_4265_4996 243
108 3300042609 Ga0466722_188440 Ga0466722_188440_786_1562 245
109 3300042590 Ga0466690_002751 Ga0466690_002751_13996_14772 258
110 3300042591 Ga0466692_106643 Ga0466692_106643_4638_5414 258
111 3300042593 Ga0466691_014585 Ga0466691_014585_7794_8570 258
112 3300042605 Ga0466716_119424 Ga0466716_119424_29076_29852 258
113 3300042606 Ga0466719_145174 Ga0466719_145174_15108_15884 258
114 3300042612 Ga0466705_481415 Ga0466705_481415_6882_7658 258
115 3300042615 Ga0466711_310728 Ga0466711_310728_1111_1887 258
116 3300042618 Ga0466723_069830 Ga0466723_069830_14289_15065 258
117 3300042618 Ga0466723_287515 Ga0466723_287515_13157_13933 258
118 3300042620 Ga0466728_103464 Ga0466728_103464_20299_21075 258
119 3300042624 Ga0466735_053746 Ga0466735_053746_890_1666 258
120 3300042636 Ga0466703_315219 Ga0466703_315219_11613_12389 258
121 3300042643 Ga0466704_133824 Ga0466704_133824_13651_14427 258
122 3300042648 Ga0466709_104493 Ga0466709_104493_1844_2620 258
123 3300002449 JGI24698J34947_10001843 JGI24698J34947_100018437 259
124 3300002449 JGI24698J34947_10007900 JGI24698J34947_100079004 259
125 3300002449 JGI24698J34947_10051179 JGI24698J34947_100511792 259
126 3300002449 JGI24698J34947_10075599 JGI24698J34947_100755993 259
127 3300005201 Ga0072941_1006115 Ga0072941_10061153 259
128 3300042591 Ga0466692_162226 Ga0466692_162226_61_840 259
129 3300009784 Ga0123357_10125138 Ga0123357_101251383 260
130 3300042609 Ga0466722_140791 Ga0466722_140791_17945_18733 262
131 2030936001 Nasutiter_Contig18609 Nasutiterm_2196770 268
132 3300010882 Ga0123354_10378206 Ga0123354_103782062 269
133 3300002449 JGI24698J34947_10060740 JGI24698J34947_100607403 272
134 3300002449 JGI24698J34947_10002702 JGI24698J34947_100027029 275

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00226 DnaJ DnaJ domain 44 104 0.93

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6rzy-assembly2.cif.gz_B Plasmodium falciparum PFA0660w Hsp40 co-chaperone J-domain 0.956 45 104
2och-assembly1.cif.gz_A J-domain of dnj-12 from Caenorhabditis elegans 0.934 41 106
5nro-assembly1.cif.gz_B Structure of full-length DnaK with bound J-domain 0.93 45 101
6iws-assembly1.cif.gz_A Solution structure of the J-domain of Tid1, a Mitochondrial Hsp40/DnaJ Protein 0.917 44 104
6d6x-assembly1.cif.gz_A HSP40 co-chaperone Sis1 J-domain 0.912 43 105
IDDescriptionScoreStartEndSuperfamily
af_E9AGR0_1_83_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9619 41 112 1.10.287.110
af_Q7YWX3_8_87_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9572 44 106 1.10.287.110
af_A4I249_279_389_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9547 43 104 1.10.287.110
af_A0A0R0EVG5_46_123_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9544 41 111 1.10.287.110
af_Q55D57_37_119_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9531 45 109 1.10.287.110
IDDescriptionScoreStartEndGO Terms
AF-A0A7X8B3I5-F1-model_v4 Uncharacterized/unreviewed 0.9953 45 101
AF-A0A812RHH7-F1-model_v4 Uncharacterized/unreviewed 0.9771 45 108

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.