


| Basic Information | |
|---|---|
| Family ID | F055534 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 18.12 % |
| % of genes from short scaffolds (< 2000 bps) | 50.72 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (35.507 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (38.406 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.841 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.609 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF05866 | RusA | 17.39 |
| PF07120 | DUF1376 | 13.04 |
| PF13392 | HNH_3 | 6.52 |
| PF14549 | P22_Cro | 4.35 |
| PF04404 | ERF | 4.35 |
| PF01555 | N6_N4_Mtase | 3.62 |
| PF00182 | Glyco_hydro_19 | 2.17 |
| PF00196 | GerE | 1.45 |
| PF02086 | MethyltransfD12 | 1.45 |
| PF05766 | NinG | 1.45 |
| PF05869 | Dam | 1.45 |
| PF05772 | NinB | 1.45 |
| PF04466 | Terminase_3 | 1.45 |
| PF03237 | Terminase_6N | 0.72 |
| PF02195 | ParBc | 0.72 |
| PF01467 | CTP_transf_like | 0.72 |
| PF01695 | IstB_IS21 | 0.72 |
| PF13463 | HTH_27 | 0.72 |
| PF15943 | YdaS_antitoxin | 0.72 |
| PF05063 | MT-A70 | 0.72 |
| PF03245 | Phage_lysis | 0.72 |
| PF09588 | YqaJ | 0.72 |
| PF01844 | HNH | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 17.39 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 13.04 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.62 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.62 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.62 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 2.17 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 2.17 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.45 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.45 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.45 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.57 % |
| Unclassified | root | N/A | 30.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c013615 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c000356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8920 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1012686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4399 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1015897 | Not Available | 3713 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1026617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2513 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1028103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2413 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10039403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3097 | Open in IMG/M |
| 3300002307|JGI24890J29729_1004338 | Not Available | 4686 | Open in IMG/M |
| 3300003375|JGI26470J50227_1007467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2894 | Open in IMG/M |
| 3300003375|JGI26470J50227_1007635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2848 | Open in IMG/M |
| 3300003375|JGI26470J50227_1007967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2772 | Open in IMG/M |
| 3300003375|JGI26470J50227_1008536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2651 | Open in IMG/M |
| 3300003375|JGI26470J50227_1012443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2067 | Open in IMG/M |
| 3300003375|JGI26470J50227_1032503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| 3300003375|JGI26470J50227_1033140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300003375|JGI26470J50227_1038292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300003375|JGI26470J50227_1039634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300003783|Ga0007850_1000344 | All Organisms → Viruses → Predicted Viral | 4793 | Open in IMG/M |
| 3300003787|Ga0007811_1000438 | Not Available | 6323 | Open in IMG/M |
| 3300003787|Ga0007811_1000548 | Not Available | 5724 | Open in IMG/M |
| 3300003787|Ga0007811_1002794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2218 | Open in IMG/M |
| 3300003787|Ga0007811_1018931 | Not Available | 601 | Open in IMG/M |
| 3300003789|Ga0007835_1002945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1951 | Open in IMG/M |
| 3300003800|Ga0007860_1008259 | Not Available | 751 | Open in IMG/M |
| 3300003823|Ga0007875_1002014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2838 | Open in IMG/M |
| 3300004177|Ga0066411_1000045 | All Organisms → cellular organisms → Bacteria | 18746 | Open in IMG/M |
| 3300004684|Ga0065168_1020941 | Not Available | 1027 | Open in IMG/M |
| 3300004687|Ga0065174_1004001 | All Organisms → Viruses → Predicted Viral | 2646 | Open in IMG/M |
| 3300004692|Ga0065171_1003993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2333 | Open in IMG/M |
| 3300004692|Ga0065171_1029762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300004694|Ga0065170_1000489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5502 | Open in IMG/M |
| 3300004770|Ga0007804_1057770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
| 3300004807|Ga0007809_10103372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300005288|Ga0065714_10288069 | Not Available | 712 | Open in IMG/M |
| 3300005468|Ga0070707_102142549 | Not Available | 527 | Open in IMG/M |
| 3300005664|Ga0073685_1024448 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300006037|Ga0075465_10003795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2631 | Open in IMG/M |
| 3300006056|Ga0075163_10100894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3474 | Open in IMG/M |
| 3300006071|Ga0007876_1003782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4675 | Open in IMG/M |
| 3300006071|Ga0007876_1004453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4258 | Open in IMG/M |
| 3300006071|Ga0007876_1016738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2083 | Open in IMG/M |
| 3300006071|Ga0007876_1038277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
| 3300006072|Ga0007881_1123049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300006072|Ga0007881_1128429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300006104|Ga0007882_10179068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300006105|Ga0007819_1084356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300006123|Ga0007852_1129804 | Not Available | 545 | Open in IMG/M |
| 3300006128|Ga0007828_1011926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300006805|Ga0075464_10463603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 774 | Open in IMG/M |
| 3300006917|Ga0075472_10608121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 548 | Open in IMG/M |
| 3300006920|Ga0070748_1049407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1675 | Open in IMG/M |
| 3300007363|Ga0075458_10058985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1204 | Open in IMG/M |
| 3300007363|Ga0075458_10090970 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300008120|Ga0114355_1205287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 629 | Open in IMG/M |
| 3300008266|Ga0114363_1002639 | Not Available | 9962 | Open in IMG/M |
| 3300008267|Ga0114364_1016119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3229 | Open in IMG/M |
| 3300008448|Ga0114876_1118878 | Not Available | 1017 | Open in IMG/M |
| 3300009175|Ga0073936_10005907 | Not Available | 16353 | Open in IMG/M |
| 3300009502|Ga0114951_10129279 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300009676|Ga0116187_1186303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 980 | Open in IMG/M |
| 3300010342|Ga0116252_10297869 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Peloderinae → Caenorhabditis → Caenorhabditis remanei | 957 | Open in IMG/M |
| 3300011009|Ga0129318_10256202 | Not Available | 580 | Open in IMG/M |
| 3300011011|Ga0139556_1040329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae | 688 | Open in IMG/M |
| 3300012018|Ga0119867_1166848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 585 | Open in IMG/M |
| 3300012956|Ga0154020_10860750 | Not Available | 711 | Open in IMG/M |
| 3300013093|Ga0164296_1047411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
| 3300013800|Ga0119898_1050005 | Not Available | 527 | Open in IMG/M |
| 3300014960|Ga0134316_1008177 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300017700|Ga0181339_1000085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 37806 | Open in IMG/M |
| 3300017736|Ga0181365_1000008 | Not Available | 37517 | Open in IMG/M |
| 3300019784|Ga0181359_1079685 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300020686|Ga0214194_102260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2029 | Open in IMG/M |
| 3300020686|Ga0214194_102481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1911 | Open in IMG/M |
| 3300020707|Ga0214238_1023646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300020710|Ga0214198_1000076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29262 | Open in IMG/M |
| 3300020710|Ga0214198_1006393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1610 | Open in IMG/M |
| 3300020711|Ga0214237_1002550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3320 | Open in IMG/M |
| 3300020714|Ga0214182_1010485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1609 | Open in IMG/M |
| 3300020716|Ga0214207_1000073 | Not Available | 32070 | Open in IMG/M |
| 3300020716|Ga0214207_1013101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300020729|Ga0214251_1016585 | Not Available | 1357 | Open in IMG/M |
| 3300020731|Ga0214170_1021946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1087 | Open in IMG/M |
| 3300020733|Ga0214172_1015426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300021124|Ga0214199_1002549 | All Organisms → Viruses → Predicted Viral | 2768 | Open in IMG/M |
| 3300021127|Ga0214193_1027190 | Not Available | 679 | Open in IMG/M |
| 3300021131|Ga0214206_1001885 | Not Available | 4641 | Open in IMG/M |
| 3300021131|Ga0214206_1013016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300021133|Ga0214175_1001665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4796 | Open in IMG/M |
| 3300021135|Ga0214247_1015305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1464 | Open in IMG/M |
| 3300021136|Ga0214167_1042985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300021138|Ga0214164_1009433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3502 | Open in IMG/M |
| 3300021139|Ga0214166_1035201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
| 3300021142|Ga0214192_1015323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2895 | Open in IMG/M |
| 3300021440|Ga0213919_1095933 | Not Available | 613 | Open in IMG/M |
| 3300022555|Ga0212088_10007900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18062 | Open in IMG/M |
| 3300022602|Ga0248169_104874 | Not Available | 13813 | Open in IMG/M |
| 3300022744|Ga0228700_1021160 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300022744|Ga0228700_1087341 | Not Available | 646 | Open in IMG/M |
| 3300024958|Ga0208263_108219 | All Organisms → Viruses → Predicted Viral | 2209 | Open in IMG/M |
| 3300025357|Ga0208383_1013946 | Not Available | 990 | Open in IMG/M |
| 3300025358|Ga0208504_1000108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21342 | Open in IMG/M |
| 3300025358|Ga0208504_1034775 | Not Available | 633 | Open in IMG/M |
| 3300025366|Ga0208505_1000358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9264 | Open in IMG/M |
| 3300025369|Ga0208382_1009225 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
| 3300025372|Ga0207957_1012734 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300025379|Ga0208738_1000953 | Not Available | 6903 | Open in IMG/M |
| 3300025379|Ga0208738_1003307 | Not Available | 3223 | Open in IMG/M |
| 3300025379|Ga0208738_1005298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2403 | Open in IMG/M |
| 3300025383|Ga0208250_1000482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11681 | Open in IMG/M |
| 3300025383|Ga0208250_1010813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1701 | Open in IMG/M |
| 3300025402|Ga0208876_1033190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300025407|Ga0208378_1000096 | Not Available | 32987 | Open in IMG/M |
| 3300025407|Ga0208378_1000121 | Not Available | 28894 | Open in IMG/M |
| 3300025407|Ga0208378_1001645 | Not Available | 6201 | Open in IMG/M |
| 3300025410|Ga0208875_1035226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300025413|Ga0208614_1019122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300025417|Ga0208616_1001135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6022 | Open in IMG/M |
| 3300025451|Ga0208426_1002260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2691 | Open in IMG/M |
| 3300025720|Ga0208197_1225635 | Not Available | 567 | Open in IMG/M |
| 3300025779|Ga0208869_1002213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3679 | Open in IMG/M |
| 3300025896|Ga0208916_10083407 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
| 3300025910|Ga0207684_11398092 | Not Available | 573 | Open in IMG/M |
| 3300027911|Ga0209698_10070905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2980 | Open in IMG/M |
| 3300031758|Ga0315907_10064031 | All Organisms → Viruses → Predicted Viral | 3200 | Open in IMG/M |
| 3300031759|Ga0316219_1010962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5130 | Open in IMG/M |
| 3300031759|Ga0316219_1130233 | Not Available | 943 | Open in IMG/M |
| 3300031759|Ga0316219_1169626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300031813|Ga0316217_10007486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10412 | Open in IMG/M |
| 3300031813|Ga0316217_10133769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300031857|Ga0315909_10001170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 35552 | Open in IMG/M |
| 3300032665|Ga0316221_1020483 | Not Available | 3218 | Open in IMG/M |
| 3300032675|Ga0316225_1199946 | Not Available | 621 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 38.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 16.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 9.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.17% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.17% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.17% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.45% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater | 0.72% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.72% |
| Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.72% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.72% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.72% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003800 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300004177 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 15_LOW5 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013800 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - ZZ_EW_meta | Engineered | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020707 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020714 | Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020729 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021440 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MG | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300022744 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024958 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 28_LOW6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025366 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025779 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0136151 | 3300000176 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPFTTITWALWVLGDAVGI* |
| TB18AUG2009E_00035622 | 3300000203 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPFTTITWALWVLGDA |
| TBL_comb48_EPIDRAFT_10126868 | 3300000439 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGLR* |
| TBL_comb48_EPIDRAFT_10158979 | 3300000439 | Freshwater | MRNHYNLEELEAARILDLVRLGDDTVPCSVITWALFVLGDAIGCN* |
| TBL_comb48_EPIDRAFT_10266173 | 3300000439 | Freshwater | MRNHYNYEELEAAQILDLVRMGDDSVPWTAITWALWVLGDAVGN* |
| TBL_comb48_EPIDRAFT_10281037 | 3300000439 | Freshwater | MRNHYNLEELEAARILDLVRMGDDSVPWTAITWALWVLGDAIGLS* |
| TBL_comb47_HYPODRAFT_1003940311 | 3300000553 | Freshwater | MRDNYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGH* |
| JGI24890J29729_10043388 | 3300002307 | Lentic | MREHYNDEEKEAARXLDLVRMGDETVPWSVITWSLWVLGDAVGH* |
| JGI26470J50227_10074676 | 3300003375 | Freshwater | MRDHYNFEELEAARILDLVRMGDKTIPWTVITWALWCLGDAVGQ* |
| JGI26470J50227_10076354 | 3300003375 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPCSVITWALWVLGDAVGN* |
| JGI26470J50227_10079677 | 3300003375 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGH* |
| JGI26470J50227_10085363 | 3300003375 | Freshwater | MRNHYNFEELEAARILDLVRLGDDTVPCSVITWALFVLGDAIGCN* |
| JGI26470J50227_10124433 | 3300003375 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGN* |
| JGI26470J50227_10325032 | 3300003375 | Freshwater | MRNYYNHEELEAARILDLVRMGDDSVPWTAITWALFVLGDAVGLR* |
| JGI26470J50227_10331401 | 3300003375 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN* |
| JGI26470J50227_10382923 | 3300003375 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTTITWALWVLGDAVGN* |
| JGI26470J50227_10396341 | 3300003375 | Freshwater | MRNHYNHEELEAARILDLVRMGDNSVPWTAITWALWVLGDAVGN* |
| Ga0007850_100034413 | 3300003783 | Freshwater | MREHYNDEEREAARILDLVRMGDKNIPRSVINWALWCLGDAVGQ* |
| Ga0007811_100043818 | 3300003787 | Freshwater | MRNNYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0007811_100054810 | 3300003787 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI* |
| Ga0007811_10027945 | 3300003787 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0007811_10189311 | 3300003787 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTTITWALWVLGDAVGI* |
| Ga0007835_10029456 | 3300003789 | Freshwater | MREHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGQ* |
| Ga0007860_10082591 | 3300003800 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAV |
| Ga0007875_10020145 | 3300003823 | Freshwater | MRDHYNHEELEAARILDLIRMGDDSVPWTTITWALFVLGDAVGLR* |
| Ga0066411_100004512 | 3300004177 | Freshwater Sediment | MRNLMNEEEREASHILDLIRYGGDVPASAITWALWVLGDLEAL* |
| Ga0065168_10209414 | 3300004684 | Freshwater | MRDHYNFEELEAAQILDLVRMGDDSVPWTTITWALWVLGDAVGN* |
| Ga0065174_10040013 | 3300004687 | Freshwater | MRDHYNHEELEAARILDLVRIGDDSVPWTAITWALWVLGDAVGI* |
| Ga0065171_10039934 | 3300004692 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI* |
| Ga0065171_10297623 | 3300004692 | Freshwater | MRNHYNHEELEAARILDLVRMGDETVPCSIITWALFVLGDAIGCQ* |
| Ga0065170_10004895 | 3300004694 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAIGLS* |
| Ga0007804_10577704 | 3300004770 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGQ* |
| Ga0007809_101033723 | 3300004807 | Freshwater | MRDQYDYEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0065714_102880692 | 3300005288 | Miscanthus Rhizosphere | MRDQYNHEELEAARILDLARAGGDVPASAITWSLWILGDLVGARQ* |
| Ga0070707_1021425493 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EGGERMRDQYNHEELEAARILDLARAGGDVPDSAITWSLWILGDLVGVAQ* |
| Ga0073685_10244483 | 3300005664 | Aquatic | MRTHMNHEELEASRLLDFARAGGDVPATTITWALWVLGDLVEVAA* |
| Ga0075465_100037952 | 3300006037 | Aqueous | MRSNYNPEEREAARVLDLARAGGDVPASTVTWALWVLGDLVGVA* |
| Ga0075465_101416652 | 3300006037 | Aqueous | MRSHYNHEEREAASVLDLARAGGDVPASTVTWALWVLGDLVGVA* |
| Ga0075163_101008944 | 3300006056 | Wastewater Effluent | MRQHMNHEELEASRILDLARAGGDVPVSTITWALWVLGDMSQWPG* |
| Ga0075163_101096151 | 3300006056 | Wastewater Effluent | MRNNMNDEELEASRILDLVRAGGDVPDSVIIWALWTTGDLVGQ* |
| Ga0075163_101382402 | 3300006056 | Wastewater Effluent | MNHEELEASRILDFAKAGGEVPDSTITWALWVLGDMSQWPG* |
| Ga0007876_10037827 | 3300006071 | Freshwater | MRENYNHEELEAARILDLVRMGDNTVPWTTITWALWVLGDAVGN* |
| Ga0007876_10044538 | 3300006071 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAIGN* |
| Ga0007876_10167387 | 3300006071 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTTITWALWVLGDAVGI* |
| Ga0007876_10382773 | 3300006071 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVG |
| Ga0007881_11230491 | 3300006072 | Freshwater | GVNLMRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0007881_11284292 | 3300006072 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN* |
| Ga0007882_101790683 | 3300006104 | Freshwater | VDGVNLMRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0007819_10843561 | 3300006105 | Freshwater | DGVNLMRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0007852_11298041 | 3300006123 | Freshwater | EELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI* |
| Ga0007828_10119263 | 3300006128 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPFTTITWALWVLGDAVGN* |
| Ga0075464_104636033 | 3300006805 | Aqueous | HYNYEEREAARILDLVRAGGDAPESVITWALWVLGDFIGG* |
| Ga0075472_106081211 | 3300006917 | Aqueous | DCTNEGVSMRNHYNYEEREAARILDLVRAGGDAPESVITWALWVLGDFIGG* |
| Ga0070748_10494072 | 3300006920 | Aqueous | MRNQYNQEELEASRILDLVRAGGDVPATTVTWALWVLGDLVGQ* |
| Ga0075458_100589852 | 3300007363 | Aqueous | MRNHYNYEEREAARILDLVRAGGDAPESVITWALWVLGDFIGG* |
| Ga0075458_100909701 | 3300007363 | Aqueous | MRNHYNYEEREAARILDLVRAGGDAPESVITWALWVL |
| Ga0105050_104236421 | 3300007516 | Freshwater | MRDHMNHEELEAAHILDWLREGGDVPDSTVVWCLFVLGDLDSLRDFY* |
| Ga0105051_102618781 | 3300007722 | Freshwater | MRDHMNHEELEAAHILDWLREGGDVPDSTVVWCLWVLGDLE |
| Ga0114355_12052872 | 3300008120 | Freshwater, Plankton | MRDQFNHEELEAMRILDAVKAGIDVPATAITWALWVTGDLVGQAA* |
| Ga0114363_100263915 | 3300008266 | Freshwater, Plankton | MRDQFNHEELEAMRILDAVKAGIDVPETAITWALWVTGDLVGQAA* |
| Ga0114364_10161195 | 3300008267 | Freshwater, Plankton | MRNTYNHEELEAARILDLARIGGDVPDSAITWALWTLGDLVGCV* |
| Ga0114876_11188782 | 3300008448 | Freshwater Lake | MRNNYNEEEKEATRILDLARAGGDVPESTITWALWVLGDLVG* |
| Ga0073936_100059073 | 3300009175 | Freshwater Lake Hypolimnion | MREHYNDEEKEAARILDLVRMGDETVPWSVITWSLWVLGDAVGH* |
| Ga0114951_101292795 | 3300009502 | Freshwater | YNDEEKEAARILDLVRMGDKTVPWSVITWSLWVLGDAVGH* |
| Ga0116187_11863032 | 3300009676 | Anaerobic Digestor Sludge | MRQHMNHEELEASRILDLARAGGDVPASTITWALWVLGDLVQWSQ* |
| Ga0116252_102978693 | 3300010342 | Anaerobic Digestor Sludge | MNHEELEASRILDLARAGGDVPASTITWALWVLGDLVQWSQ* |
| Ga0129318_102562021 | 3300011009 | Freshwater To Marine Saline Gradient | GPREERTASMRQHMNHEELEASRILDLARAGGDVPVSTITWALWVLGDMSQWPG* |
| Ga0139556_10403291 | 3300011011 | Freshwater | MRQHMNYEELEASRILDLALNGGDVPDSVITWALF |
| Ga0119867_11668482 | 3300012018 | Activated Sludge | MRNLYNDEEREAARILDLVRIGGDVPESAVTWALWVLGDLVGMNNA* |
| Ga0154020_103603443 | 3300012956 | Active Sludge | MNHEELEASHVLDLARAGGDVPDSVVIWALWVLGDLERM* |
| Ga0154020_108607502 | 3300012956 | Active Sludge | MRQHMNHEELEASRILDLARAGGDVPASTITWALWVLGDMSQWPG* |
| Ga0164296_10474113 | 3300013093 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH* |
| Ga0119898_10500052 | 3300013800 | Wastewater | MRANMNHEEMEASRLLDFARAGGDVPDTAITWALWTLGD |
| Ga0134316_10081772 | 3300014960 | Surface Water | LRDKYNHEELEAARILDLVKVGGEVTEDTITWALWVLGDLVGV* |
| Ga0181339_100008542 | 3300017700 | Freshwater Lake | MRNHYNHEELEASRILDLARAGGDVPGSVVTWALWVLGDLVGL |
| Ga0181365_100000863 | 3300017736 | Freshwater Lake | MRNTYNHDELEASRILDLARIGGDVPESAITWALWTLGDLVGVAA |
| Ga0181359_10796852 | 3300019784 | Freshwater Lake | MRKNLNYEEKEAMRILDAVKFGIDIPESLINWALWVCGDLVGQQS |
| Ga0214194_1022604 | 3300020686 | Freshwater | MRNHYNYEELEAAQILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0214194_1024816 | 3300020686 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGLR |
| Ga0214238_10236462 | 3300020707 | Freshwater | MRDNYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGH |
| Ga0214198_100007634 | 3300020710 | Freshwater | MRDHYNFEELEAARILDLVRMGDKTIPWTVITWALWCLGDAVGQ |
| Ga0214198_10063934 | 3300020710 | Freshwater | MRSHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0214237_10025503 | 3300020711 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH |
| Ga0214182_10104851 | 3300020714 | Freshwater | ELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0214207_100007351 | 3300020716 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPFTTITWALWVLGDAVGI |
| Ga0214207_10131011 | 3300020716 | Freshwater | MRNYYNHEELEAARILDLVRMGDDSVPWTAITWALFVLGDAVGLR |
| Ga0214251_10165853 | 3300020729 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI |
| Ga0214170_10219463 | 3300020731 | Freshwater | MRDHYNFEELEAARILDLVRLGDDSVPWTAITWALWVLGDAVGI |
| Ga0214172_10154265 | 3300020733 | Freshwater | EELEAARILDLVRLGDDSVPWTAITWALWVLGDAVGI |
| Ga0214199_10025491 | 3300021124 | Freshwater | VVGVNLMRDHYNFEELEAARILDLVRMGDKTIPWTVITWALWCLGDAVGQ |
| Ga0214193_10271903 | 3300021127 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALF |
| Ga0214206_10018853 | 3300021131 | Freshwater | MRNHYNLEELEAARILDLVRMGDDSVPWTAITWALWVLGDAIGLS |
| Ga0214206_10130161 | 3300021131 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAIG |
| Ga0214175_10016657 | 3300021133 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGH |
| Ga0214247_10153053 | 3300021135 | Freshwater | MRNYYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0214167_10429853 | 3300021136 | Freshwater | MRNYYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH |
| Ga0214164_10094336 | 3300021138 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPCSVITWALWVLGDAVGN |
| Ga0214166_10352013 | 3300021139 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAIGLS |
| Ga0214192_10153232 | 3300021142 | Freshwater | MRNHYNHEELEAARILDLVRLGDETVPCSIITWALFVLGDAIGCQ |
| Ga0213919_10959332 | 3300021440 | Freshwater | MRNHMNYEELEASRILDLARAGEDVPETVIVWAFLVLGDMQRIWNG |
| Ga0212088_100079009 | 3300022555 | Freshwater Lake Hypolimnion | MREHYNDEEKEAARILDLVRMGDETVPWSVITWSLWVLGDAVGH |
| Ga0248169_10487418 | 3300022602 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGN |
| Ga0228700_10211601 | 3300022744 | Freshwater | MRDHLNHEELEAMRILDAARVGIDVPESAITWALWVTGDLVGQPA |
| Ga0228700_10873412 | 3300022744 | Freshwater | MRDQYNHEEREAARILDLARAGGDVPESVITWALWCMGDLVGT |
| Ga0208263_1082192 | 3300024958 | Freshwater | MRNLMNEEEREASHILDLIRYGGDVPASAITWALWVLGDLEAL |
| Ga0208383_10139463 | 3300025357 | Freshwater | MRNHYNHEELEAAQILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0208504_100010817 | 3300025358 | Freshwater | MREHYNDEEREAARILDLVRMGDKNIPRSVINWALWCLGDAVGQ |
| Ga0208504_10347753 | 3300025358 | Freshwater | MREHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGQ |
| Ga0208505_10003582 | 3300025366 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0208382_10092255 | 3300025369 | Freshwater | HEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI |
| Ga0207957_10127344 | 3300025372 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI |
| Ga0208738_100095319 | 3300025379 | Freshwater | MRNNYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH |
| Ga0208738_10033074 | 3300025379 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTTITWALWVLGDAVGI |
| Ga0208738_10052985 | 3300025379 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGH |
| Ga0208250_100048217 | 3300025383 | Freshwater | MRDHYNHEELEAARILDLIRMGDDSVPWTTITWALFVLGDAVGLR |
| Ga0208250_10108133 | 3300025383 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0208876_10331902 | 3300025402 | Freshwater | MRDDYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI |
| Ga0208378_100009622 | 3300025407 | Freshwater | MRENYNHEELEAARILDLVRMGDNTVPWTTITWALWVLGDAVGN |
| Ga0208378_100012120 | 3300025407 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAIGN |
| Ga0208378_100164511 | 3300025407 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTTITWALWVLGDAVGI |
| Ga0208875_10352263 | 3300025410 | Freshwater | MRDHYNHEELEAARILDLVRIGDDSVPWTAITWALWVLGDAVGI |
| Ga0208614_10191224 | 3300025413 | Freshwater | MRDHYNFEELEAAQILDLVRMGDDSVPWTTITWALWVLGDAVGN |
| Ga0208616_10011354 | 3300025417 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPFTTITWALWVLGDAVGN |
| Ga0208426_10022604 | 3300025451 | Aqueous | MRSNYNPEEREAARVLDLARAGGDVPASTVTWALWVLGDLVGVA |
| Ga0208197_12256353 | 3300025720 | Anaerobic Digestor Sludge | MRQHMNHEELEASRILDLARAGGDVPASTITWALWVLGDLVQWSQ |
| Ga0208869_10022138 | 3300025779 | Freshwater | MRDHYNFEELEAARILDLVRMGDDSVPWTAITWALFVLGDAVGLR |
| Ga0208916_100834072 | 3300025896 | Aqueous | MRQHMNHEELEASRILDLARAGGDVPVSTITWALWVLGDMSQWPG |
| Ga0207684_113980921 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDQYNHEELEAARILDLARAGGDVPASVVTWALWCLGDLVGVRT |
| Ga0209698_100709058 | 3300027911 | Watersheds | MRNHYNHEELEAARILDLVRMGDESVPFSTITWCLWVLGDAVGN |
| Ga0315907_100640317 | 3300031758 | Freshwater | MRNNYNEEEKEATRILDLARAGGDVPESTITWALWVLGDLVG |
| Ga0316219_10109628 | 3300031759 | Freshwater | MRNHYNLEELEAARILDLVRMGDDSVPFTTITWCLWVLGDAVGN |
| Ga0316219_11302332 | 3300031759 | Freshwater | VRDHYNFEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI |
| Ga0316219_11696261 | 3300031759 | Freshwater | EELEAARILDLVRMGDDSVPWTAITWALWVLGDAVGI |
| Ga0316217_1000748620 | 3300031813 | Freshwater | MRDHYNHEELEAARILDLVRMGDDSVPWTAITWALFVLGDAVGLR |
| Ga0316217_101337693 | 3300031813 | Freshwater | MRNHYNHEEFEAARILDLVRMGDDSVPWTAITWALWVLGDAVGN |
| Ga0315909_100011706 | 3300031857 | Freshwater | MRDQFNHEELEAMRILDAVKAGIDVPETAITWALWVTGDLVGQAA |
| Ga0316221_10204838 | 3300032665 | Freshwater | MRNHYNHEELEAARILDLVRMGDDSVPWTAITWALWVLGDAVCN |
| Ga0316225_11999462 | 3300032675 | Freshwater | MRENYNHEKLEAARILDLVRMGDSTVPWTAITWALWVLGDAVGH |
| ⦗Top⦘ |